DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Ppp3r2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_067733.1 Gene:Ppp3r2 / 29749 RGDID:69232 Length:176 Species:Rattus norvegicus


Alignment Length:189 Identity:39/189 - (20%)
Similarity:84/189 - (44%) Gaps:33/189 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPSARIGF 82
            :..|....:::::|...|:.:|..:.|.|:..:.:.:|:|..|||..::||.|  ..|.:..:.|
  Rat    10 EMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVIDIF--DTDGNGEVDF 72

  Fly    83 KQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIV--NLA-W 144
            ::|:          .|......:....|||:...:::|....|.|:..:..|:::.:|  ||. |
  Rat    73 REFI----------VGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMVGNNLKDW 127

  Fly   145 SQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVDRRLSI 203
            ..||              .|:..:.:|:....|    .||:.||...:.::::.::|.:
  Rat   128 QLQQ--------------LVDKSILVLDKDGDG----RISFEEFRDVVRTMEIHKKLVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 24/104 (23%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
Ppp3r2NP_067733.1 FRQ1 13..157 CDD:227455 38/173 (22%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:P63098 131..136 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350468
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.