DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Ppp3r1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_006251579.3 Gene:Ppp3r1 / 29748 RGDID:69230 Length:216 Species:Rattus norvegicus


Alignment Length:202 Identity:43/202 - (21%)
Similarity:93/202 - (46%) Gaps:38/202 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDG 69
            |:....|:::|.|     ..|:::::|..||:.||....|.|:..:.:.:|:|..|||.:::||.
  Rat    48 GNEASYPLEMCSH-----FDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDI 107

  Fly    70 FFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQ 134
            |  ..|.:..:.||:|::..|...|          :..:.|||:...:::|..:.|.|:..:..|
  Rat   108 F--DTDGNGEVDFKEFIEGVSQFSV----------KGDKEQKLRFAFRIYDMDKDGYISNGELFQ 160

  Fly   135 IMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCD---HISYGEFEKRLFSVD 196
            :::.:|.                 |.|.:.:.: |:::........|   .||:.||...:..:|
  Rat   161 VLKMMVG-----------------NNLKDTQLQ-QIVDKTIINADKDGDGRISFEEFCAVVGGLD 207

  Fly   197 VDRRLSI 203
            :.:::.:
  Rat   208 IHKKMVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 28/104 (27%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
Ppp3r1XP_006251579.3 PTZ00184 64..200 CDD:185504 36/165 (22%)
EFh 71..126 CDD:238008 18/56 (32%)
EFh 137..203 CDD:238008 15/83 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.