DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Tescl

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001099703.1 Gene:Tescl / 292706 RGDID:1311676 Length:232 Species:Rattus norvegicus


Alignment Length:209 Identity:53/209 - (25%)
Similarity:87/209 - (41%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRD---- 75
            ||      .|.:|::|||.|||.|...| ..|.|.:...:..|..||:..:|:..||.:|:    
  Rat    32 CD------FSWDQIKQLHQRFRLLSGDQ-PTLRPENFDNVLDLEFNPIRSRIVRAFFDNRNLGKG 89

  Fly    76 ---PSARIGFKQFVDTCSTI--LVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQI 135
               .:..|.|:.|:...|..  |.|:..:....:.  |.:|:|.|..|:|....|.||..::|::
  Rat    90 TSGLAEEITFQDFLTIISYFRPLEPRPNKEEAEQY--RKEKMQFLFNMYDQDGDGIITLQEYRRV 152

  Fly   136 ---------------MRSIVN-------LAWSQQQDQ-----ERQEGLS--------ENRLPEVE 165
                           :||:.|       :..|:..||     |..||::        ::...||:
  Rat   153 VEDLLSANPQAETATVRSVANSIARVALMEASRASDQPLNEDEPYEGITFEDFFKTWQSLELEVK 217

  Fly   166 AELQLLEHQAFGFC 179
            .::..|..||..||
  Rat   218 MQVSFLNLQAMAFC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 32/128 (25%)
EF-hand_6 117..139 CDD:290141 7/36 (19%)
TesclNP_001099703.1 PTZ00183 30..206 CDD:185503 46/182 (25%)
EFh 128..>165 CDD:298682 9/36 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350448
Domainoid 1 1.000 47 1.000 Domainoid score I11710
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.710

Return to query results.
Submit another query.