DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Tesc

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_006249488.1 Gene:Tesc / 288689 RGDID:1566317 Length:247 Species:Rattus norvegicus


Alignment Length:224 Identity:49/224 - (21%)
Similarity:93/224 - (41%) Gaps:47/224 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGLSAEQLEQLHTRFRSLDRHQRGY--------------LTPTDLL------------------R 53
            ||.|::|:||||.||:.|...|...              :.||..|                  .
  Rat    18 TGFSSDQIEQLHRRFKQLSGDQPTIRLCSSRLCSVRSVSVPPTSQLPLSVKLQWRPVCSKENFNN 82

  Fly    54 IPQLSLNPLHRQIIDGFFPSRD-------PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQK 111
            :|.|.|||:..:|:..||.:|:       .:..|.|:.|:...|.........|..:....|.:|
  Rat    83 VPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGEEQVELSRKEK 147

  Fly   112 LQLLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAEL--QLLEHQ 174
            |:.|..|:|:...|.||..::|.::..:  |:.:...::|....:::..:.|..:..  |:...|
  Rat   148 LKFLFHMYDSDSDGRITLEEYRNVVEEL--LSGNPHIEKESARSIADGAMMEAASVCVGQMEPDQ 210

  Fly   175 AFGFCCDHISYGEFEKRLFSVDVDRRLSI 203
            .:    :.|::.:|.|....:|::.::.|
  Rat   211 VY----EGITFEDFLKIWQGIDIETKMHI 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 33/143 (23%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
TescXP_006249488.1 EFh 147..>175 CDD:298682 9/27 (33%)
EF-hand_7 148..223 CDD:290234 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350445
Domainoid 1 1.000 47 1.000 Domainoid score I11710
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.