DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Cib1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_036000.1 Gene:Cib1 / 23991 MGIID:1344418 Length:191 Species:Mus musculus


Alignment Length:191 Identity:43/191 - (22%)
Similarity:75/191 - (39%) Gaps:34/191 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRF--------RSLDRHQRGYLTPTDLLRIPQL 57
            ||..||| |:...|.::|..|.|:.:::...|.||        |:::......::...:|.:|:|
Mouse     1 MGGSGSR-LSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEQRTVEESLHTRVSFEQILSLPEL 64

  Fly    58 SLNPLHRQIIDGF--FPSRDPSARIGFKQFVDTCSTI---LVPQFGRGSVRRRDGRVQKLQLLSK 117
            ..||...:|...|  .|:||   .:.|:.|:|..|..   ..|..             |.....:
Mouse    65 KANPFKERICMVFSTSPTRD---SLSFEDFLDLLSVFSDTATPDI-------------KSHYAFR 113

  Fly   118 MFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAE----LQLLEHQ 174
            :||....|.:.|.|..|::..:.......:......:.|.:|.|.|.:.:    :.|.|.|
Mouse   114 IFDFDDDGTLDREDLSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQ 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 26/117 (22%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
Cib1NP_036000.1 EFh 111..178 CDD:238008 13/64 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846965
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.