DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and Ppp3r2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001004025.1 Gene:Ppp3r2 / 19059 MGIID:107171 Length:179 Species:Mus musculus


Alignment Length:206 Identity:49/206 - (23%)
Similarity:91/206 - (44%) Gaps:41/206 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            ||:..|.|   .:||:|     ...|::.:|...||.||..:.|.|:..:.:|:|:|..|||..:
Mouse     1 MGNEASYQ---TELCNH-----FDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGR 57

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRS 130
            :||.|  ..|.:..:.|.:|:          .|......:....|||:...:::|....|.|:..
Mouse    58 VIDIF--DTDGNGEVDFHEFI----------VGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNG 110

  Fly   131 DFRQIMRSIV--NLA-WSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRL 192
            :..|:::.:|  ||. |..||              .|:..:.:|:....|    .||:.||...:
Mouse   111 ELFQVLKMMVGNNLKDWQLQQ--------------LVDKSILVLDKDGDG----RISFEEFSDVV 157

  Fly   193 FSVDVDRRLSI 203
            .::::.::|.:
Mouse   158 KTMEIHKKLVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 27/104 (26%)
EF-hand_6 117..139 CDD:290141 4/21 (19%)
Ppp3r2NP_001004025.1 PTZ00184 17..153 CDD:185504 39/165 (24%)
EFh 25..76 CDD:238008 17/52 (33%)
EFh 91..158 CDD:238008 19/84 (23%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:Q63810 131..136 2/18 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846969
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.