DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and chpf-2

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_503830.2 Gene:chpf-2 / 186617 WormBaseID:WBGene00019108 Length:195 Species:Caenorhabditis elegans


Alignment Length:212 Identity:60/212 - (28%)
Similarity:107/212 - (50%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            ||:..|..|:..::.:....|..:..|:.:|:|||.|||::.:|||:..|.|.:|:|::|||..:
 Worm     1 MGNSNSSILSDAEMREIMDETQFNKHQILRLYTRFASLDKNGQGYLSRDDFLNVPELAVNPLGDR 65

  Fly    66 IIDGFFPSRD-----PSARIGFKQFVDTCSTILV--PQFGRGSVRRRDGRVQKLQLLSKMFDTRR 123
            |||.||...|     .|.::.|:|||    .||.  ....:......:.|..||:...||:|..:
 Worm    66 IIDAFFTLGDSDGDSKSGQLTFRQFV----RILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNK 126

  Fly   124 SGCITRSDFRQIMRSIV--NLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYG 186
            :..|||.:|:.|:.|:|  |:. |.|.|:     :::..|.|.:.:..           ..||:.
 Worm   127 NNYITREEFKVILNSMVGANIT-SDQLDK-----IADKTLEEADQDRD-----------GKISFE 174

  Fly   187 EFEKRLFSVDVDRRLSI 203
            :|.:.:...|::.::|:
 Worm   175 DFCRAMEKTDIEEKMSM 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 40/111 (36%)
EF-hand_6 117..139 CDD:290141 8/21 (38%)
chpf-2NP_503830.2 FRQ1 15..182 CDD:227455 54/187 (29%)
EFh 35..95 CDD:298682 26/63 (41%)
EFh 114..180 CDD:238008 21/82 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S676
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.