DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and chpf-1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001379127.1 Gene:chpf-1 / 179415 WormBaseID:WBGene00014109 Length:195 Species:Caenorhabditis elegans


Alignment Length:212 Identity:58/212 - (27%)
Similarity:104/212 - (49%) Gaps:30/212 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            ||:..|..|...::.:....|..:..|:.:|::||.|||:..:|:|:..|.|.:|:|::|||..:
 Worm     1 MGNSSSLMLRDEEIEEIMSETEFNRNQIVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVNPLGDR 65

  Fly    66 IIDGFFP-----SRDPSARIGFKQFVDTCSTILV--PQFGRGSVRRRDGRVQKLQLLSKMFDTRR 123
            |:|.||.     ..:...::.|:|||    .||.  ....|......:.|..||....||:|..:
 Worm    66 IVDAFFTLASSNGDNEEQQLNFRQFV----RILAHFQPISRVKKNALNSRKDKLLFAFKMYDLNK 126

  Fly   124 SGCITRSDFRQIMRSIV--NLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYG 186
            :..|||.:|:.|:.|:|  |:. |.|.|:     :::..:.|.:|:..           ..||:.
 Worm   127 NDYITREEFKVILNSMVGANIT-SDQLDK-----IADRTIEEADADRD-----------GKISFD 174

  Fly   187 EFEKRLFSVDVDRRLSI 203
            ||.:.:...|::.::||
 Worm   175 EFCRAMEKTDIEEKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 36/111 (32%)
EF-hand_6 117..139 CDD:290141 8/21 (38%)
chpf-1NP_001379127.1 FRQ1 14..182 CDD:227455 51/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S676
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.