Sequence 1: | NP_001284770.1 | Gene: | CG32812 / 31074 | FlyBaseID: | FBgn0025642 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032215.2 | Gene: | Guca1a / 14913 | MGIID: | 102770 | Length: | 202 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 45/204 - (22%) |
---|---|---|---|
Similarity: | 79/204 - (38%) | Gaps: | 69/204 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 GLSAEQLEQLHTRFRSLDRHQ--RGYLT--PTDLLRIPQL-------SLNPLHRQIIDGFFPSRD 75
Fly 76 --PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRS 138
Fly 139 IVNL-AWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFS-VDV--DR 199
Fly 200 RLSIAKWLE 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32812 | NP_001284770.1 | EF-hand_7 | 31..136 | CDD:290234 | 27/117 (23%) |
EF-hand_6 | 117..139 | CDD:290141 | 8/21 (38%) | ||
Guca1a | NP_032215.2 | FRQ1 | 12..163 | CDD:227455 | 42/199 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |