DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and guca1b

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_571946.1 Gene:guca1b / 140431 ZFINID:ZDB-GENE-011128-6 Length:197 Species:Danio rerio


Alignment Length:209 Identity:45/209 - (21%)
Similarity:79/209 - (37%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQIIDGFFPSRDPS 77
            :|.|......:...:|::.:.:|  :.....|.|...|......::.||.....|:..|.:.|.:
Zfish     4 RLSDDSDEKEIDVAELQEWYKKF--VIECPSGTLFMHDFKSFFGVTENPEAADYIENMFRAFDKN 66

  Fly    78 A--RIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIMRSIV 140
            .  .|.|.::|...:.:|     ||.:.      .||:...||:|...||||.:::.::|:.||.
Zfish    67 GDNTIDFLEYVAALNLVL-----RGKLE------HKLKWTFKMYDKDGSGCIDKTELKEIVESIY 120

  Fly   141 NLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLFSVDVDRRLSIAK 205
            .|       ::...|       |::||..||..       |.:             |||...:. 
Zfish   121 RL-------KKACHG-------ELDAECNLLTP-------DQV-------------VDRIFELV- 150

  Fly   206 WLEDDDEADAEMVL 219
                |:..|.|:.|
Zfish   151 ----DENGDGELSL 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 24/106 (23%)
EF-hand_6 117..139 CDD:290141 8/21 (38%)
guca1bNP_571946.1 FRQ1 1..171 CDD:227455 45/209 (22%)
EFh <29..77 CDD:298682 10/47 (21%)
EFh 55..116 CDD:238008 18/71 (25%)
EFh 91..168 CDD:238008 27/109 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.