DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and CHP1

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_009167.1 Gene:CHP1 / 11261 HGNCID:17433 Length:195 Species:Homo sapiens


Alignment Length:211 Identity:58/211 - (27%)
Similarity:106/211 - (50%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65
            |||..|..|...:|.:.::.||.|..|:.:|::||.|||:.:.|.|:..|..|||:|::|||..:
Human     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRD--------GRVQKLQLLSKMFDTR 122
            ||:.|||..:.  ::.|:.|:.|.:.....:   .:.:.:|        .|..||....:::|..
Human    66 IINAFFPEGED--QVNFRGFMRTLAHFRPIE---DNEKSKDVNGPEPLNSRSNKLHFAFRLYDLD 125

  Fly   123 RSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGE 187
            :...|:|.:..|::|.:|.:..|.:|    ...:::..:.|.:.:..           ..||:.|
Human   126 KDEKISRDELLQVLRMMVGVNISDEQ----LGSIADRTIQEADQDGD-----------SAISFTE 175

  Fly   188 FEKRLFSVDVDRRLSI 203
            |.|.|..|||::::||
Human   176 FVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 32/112 (29%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
CHP1NP_009167.1 FRQ1 1..182 CDD:227455 53/200 (27%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6 2/3 (67%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 2/8 (25%)
Necessary for nuclear export signal 143..185 11/56 (20%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.