DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and LOC100536377

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_003201427.1 Gene:LOC100536377 / 100536377 -ID:- Length:188 Species:Danio rerio


Alignment Length:199 Identity:49/199 - (24%)
Similarity:87/199 - (43%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRG----YLTPTDLLRIPQLSLNP 61
            ||...|: |....|.::|:.|.|:.:::...|.||..|...:.|    .::...:|.:|:|..||
Zfish     1 MGGTASK-LPKELLSEYQELTFLTKQEILLAHKRFSELQGRENGPYSSRVSMEKILTLPELKSNP 64

  Fly    62 LHRQIIDGFFPS--RDPSARIGFKQFVDTCS------TILVPQF---------GRGSVRRRDGRV 109
            ..::|...|..|  ||.|  :.|:.|:|..|      |:.:...         ..|::..||  :
Zfish    65 FRKRICHVFSTSDLRDGS--LTFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLDARD--L 125

  Fly   110 QKLQ--LLSKMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSE-----NRLPEVEAE 167
            :||.  |..:..|||    :|..:.||:   |.|:......|::....|||     :|.|:..:.
Zfish   126 EKLVNCLTGETDDTR----LTAEEMRQL---ISNILEESDIDKDGTVNLSEFQHVISRSPDFVSS 183

  Fly   168 LQLL 171
            .:::
Zfish   184 FKIV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 33/127 (26%)
EF-hand_6 117..139 CDD:290141 6/21 (29%)
LOC100536377XP_003201427.1 FRQ1 4..179 CDD:227455 46/186 (25%)
EFh 108..175 CDD:238008 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.