DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and cib3

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_003198013.2 Gene:cib3 / 100535603 ZFINID:ZDB-GENE-121121-1 Length:218 Species:Danio rerio


Alignment Length:225 Identity:48/225 - (21%)
Similarity:76/225 - (33%) Gaps:76/225 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VGSRQ--LNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLR------------- 53
            :|::|  ....||..:|..|..:.:::.:|..|:|.|    ...|.|.|...             
Zfish    32 MGNKQTIFTSQQLDAYQDCTYFTRKEILRLFHRYRDL----APQLVPLDYTNEPDVRLPYELIGS 92

  Fly    54 IPQLSLNPLHRQIIDGFFPSRDPSARIGFKQFVDTCSTI--LVPQFGRGSVRRRDGRVQKLQLLS 116
            :|:|..||..::|.:.|  |.|....:....|:|..|.:  :.|            |..|.....
Zfish    93 MPELKDNPFRQRIAEVF--SEDGQGNMTLDDFLDMFSVMSEMAP------------RDLKAYYAF 143

  Fly   117 KMFDTRRSGCITRSDFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCD 181
            |::|......|.:||..:.:..                 |:.|.|.|.|..:          .| 
Zfish   144 KIYDFNNDDFICKSDLEKTLNK-----------------LTRNELTEDEVRM----------VC- 180

  Fly   182 HISYGEFEKRLFSVDVDR--RLSIAKWLED 209
                   ||.:...|:|.  |||    |||
Zfish   181 -------EKVIDEADLDNDGRLS----LED 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 26/119 (22%)
EF-hand_6 117..139 CDD:290141 5/21 (24%)
cib3XP_003198013.2 FRQ1 40..209 CDD:227455 46/217 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.