DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32812 and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:205 Identity:45/205 - (21%)
Similarity:78/205 - (38%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ATGLSAEQLEQLHTRFRSLDRHQ--RGYLT--PTDLLRIPQL-------SLNPLHRQIIDGFFPS 73
            |.|.|.|:|.       :.:.||  |.::|  |:..|...:.       :|:....:.:...|.:
Zfish     4 APGTSVEELS-------ACESHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNEYVMTMFQT 61

  Fly    74 RD--PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIM 136
            .|  ....|.|.::|...|.||     :|.|:      |||:...|::|...||||.|.:...|:
Zfish    62 FDMNDDGCIDFMEYVAALSLIL-----KGGVQ------QKLRWYFKLYDVDGSGCIDREELLLIV 115

  Fly   137 RSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLF---SVDVD 198
            ::|..:...:|               ||.||                   ||...:|   .::.|
Zfish   116 KAIRAINGVEQ---------------EVSAE-------------------EFTNMVFEKIDLNAD 146

  Fly   199 RRLSIAKWLE 208
            ..|::.:::|
Zfish   147 GVLTMDEFME 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 27/117 (23%)
EF-hand_6 117..139 CDD:290141 8/21 (38%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 8/49 (16%)
EF-hand_7 55..112 CDD:290234 20/67 (30%)
EFh 58..116 CDD:238008 21/68 (31%)
EFh 90..159 CDD:238008 22/101 (22%)
EF-hand_7 91..158 CDD:290234 21/100 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.