Sequence 1: | NP_001284770.1 | Gene: | CG32812 / 31074 | FlyBaseID: | FBgn0025642 | Length: | 225 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_002666176.1 | Gene: | si:ch211-103a14.5 / 100330921 | ZFINID: | ZDB-GENE-091204-414 | Length: | 192 | Species: | Danio rerio |
Alignment Length: | 205 | Identity: | 45/205 - (21%) |
---|---|---|---|
Similarity: | 78/205 - (38%) | Gaps: | 68/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 ATGLSAEQLEQLHTRFRSLDRHQ--RGYLT--PTDLLRIPQL-------SLNPLHRQIIDGFFPS 73
Fly 74 RD--PSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRSDFRQIM 136
Fly 137 RSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCDHISYGEFEKRLF---SVDVD 198
Fly 199 RRLSIAKWLE 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32812 | NP_001284770.1 | EF-hand_7 | 31..136 | CDD:290234 | 27/117 (23%) |
EF-hand_6 | 117..139 | CDD:290141 | 8/21 (38%) | ||
si:ch211-103a14.5 | XP_002666176.1 | EF-hand_8 | 29..79 | CDD:290545 | 8/49 (16%) |
EF-hand_7 | 55..112 | CDD:290234 | 20/67 (30%) | ||
EFh | 58..116 | CDD:238008 | 21/68 (31%) | ||
EFh | 90..159 | CDD:238008 | 22/101 (22%) | ||
EF-hand_7 | 91..158 | CDD:290234 | 21/100 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |