DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and AT1G09995

DIOPT Version :9

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001321832.1 Gene:AT1G09995 / 837534 AraportID:AT1G09995 Length:88 Species:Arabidopsis thaliana


Alignment Length:57 Identity:15/57 - (26%)
Similarity:27/57 - (47%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 SEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSN 421
            |::|:::||.....|..|...||......|:..|..::.:.|..||.|...:.|:.:
plant    30 SQVSKKKLEDIHCSIESYLGRFQNLLRAGNMRYIQIMLILTRAFLKPLASDRNLKES 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 15/57 (26%)
DEXDc2 16..394 CDD:214693 8/28 (29%)
Helicase_C_2 659..836 CDD:290046
AT1G09995NP_001321832.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186062at2759
OrthoFinder 1 1.000 - - FOG0003100
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.