powered by:
Protein Alignment CG11403 and AT1G09995
DIOPT Version :9
Sequence 1: | NP_569898.1 |
Gene: | CG11403 / 31072 |
FlyBaseID: | FBgn0026876 |
Length: | 861 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001321832.1 |
Gene: | AT1G09995 / 837534 |
AraportID: | AT1G09995 |
Length: | 88 |
Species: | Arabidopsis thaliana |
Alignment Length: | 57 |
Identity: | 15/57 - (26%) |
Similarity: | 27/57 - (47%) |
Gaps: | 0/57 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 365 SEISRQQLERAKVQISGYKDHFQKRFTTKNLLKINQIIFIIRRLLKILDQRKELQSN 421
|::|:::||.....|..|...||......|:..|..::.:.|..||.|...:.|:.:
plant 30 SQVSKKKLEDIHCSIESYLGRFQNLLRAGNMRYIQIMLILTRAFLKPLASDRNLKES 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11403 | NP_569898.1 |
DinG |
15..841 |
CDD:224120 |
15/57 (26%) |
DEXDc2 |
16..394 |
CDD:214693 |
8/28 (29%) |
Helicase_C_2 |
659..836 |
CDD:290046 |
|
AT1G09995 | NP_001321832.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1199 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D186062at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0003100 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.