powered by:
Protein Alignment CG11403 and Y54G2A.50
DIOPT Version :9
Sequence 1: | NP_569898.1 |
Gene: | CG11403 / 31072 |
FlyBaseID: | FBgn0026876 |
Length: | 861 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001380098.1 |
Gene: | Y54G2A.50 / 3896807 |
WormBaseID: | WBGene00044493 |
Length: | 152 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 17/65 - (26%) |
Similarity: | 30/65 - (46%) |
Gaps: | 5/65 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 549 SNAEDGRILVDPVG-GTLKYILLDPAEQFADIVAEARAIVIAGGTMQP--TKELKEQLFTGCHDR 610
|.:|.|...:...| .|:....:.||..|.|...:.|:||:| |:.| ..:|.::....|.::
Worm 43 SISETGHKPISECGKTTIGLWCMSPALSFFDAFNKTRSIVLA--TLLPMARTDLNDKKRAWCSNK 105
Fly 611 610
Worm 106 105
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1199 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D186062at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.