DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11403 and Y54G2A.50

DIOPT Version :9

Sequence 1:NP_569898.1 Gene:CG11403 / 31072 FlyBaseID:FBgn0026876 Length:861 Species:Drosophila melanogaster
Sequence 2:NP_001380098.1 Gene:Y54G2A.50 / 3896807 WormBaseID:WBGene00044493 Length:152 Species:Caenorhabditis elegans


Alignment Length:65 Identity:17/65 - (26%)
Similarity:30/65 - (46%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   549 SNAEDGRILVDPVG-GTLKYILLDPAEQFADIVAEARAIVIAGGTMQP--TKELKEQLFTGCHDR 610
            |.:|.|...:...| .|:....:.||..|.|...:.|:||:|  |:.|  ..:|.::....|.::
 Worm    43 SISETGHKPISECGKTTIGLWCMSPALSFFDAFNKTRSIVLA--TLLPMARTDLNDKKRAWCSNK 105

  Fly   611  610
             Worm   106  105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11403NP_569898.1 DinG 15..841 CDD:224120 17/65 (26%)
DEXDc2 16..394 CDD:214693
Helicase_C_2 659..836 CDD:290046
Y54G2A.50NP_001380098.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1199
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D186062at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.