DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and AT1G14580

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001320583.1 Gene:AT1G14580 / 838020 AraportID:AT1G14580 Length:481 Species:Arabidopsis thaliana


Alignment Length:302 Identity:79/302 - (26%)
Similarity:112/302 - (37%) Gaps:69/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SLNTEELQFEELNERSQHQQGGSPSFVCRRCPALFLTREE----LAAHRPTHRYQGGQQTPASE- 84
            |.||..|........|....|..|:...|:..|:.:.:::    :|......|.|.|...|.:| 
plant    18 SYNTIALSSTPTFLLSSAAAGPGPNNFNRQEAAMTMVQQQPTSSVAPPPKKRRNQPGNPNPDAEV 82

  Fly    85 -------------HACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVH 136
                         ..|:.|.:.||:...|..|...||         .|.:..|:||:|     |.
plant    83 IALSPKTIMATNRFLCEVCNKGFQREQNLQLHRRGHN---------LPWKLKQKSNKE-----VR 133

  Fly   137 RKVYLHSCPEPGCKKRFQQRRECD-----QHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHG 196
            |||||  ||||.|......|...|     :|....| .|:...||.||.|::...:::.|..:.|
plant   134 RKVYL--CPEPSCVHHDPARALGDLTGIKKHYYRKH-GEKKWKCDKCSKRYAVQSDWKAHSKTCG 195

  Fly   197 SAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLI-------------RHG 248
            : |.|.|. ||.:|.|   ||.::...:.|.|.|      ....||..:             |||
plant   196 T-KEYRCD-CGTIFSR---RDSYITHRAFCDALI------QESARNPTVSFTAMAAGGGGGARHG 249

  Fly   249 LASG-----HHNDPIVRQKPQFSPALAAKNRSQRSAIDESQD 285
            ...|     .||.........|:|..||.....||:.|:.:|
plant   250 FYGGASSALSHNHFGNNPNSGFTPLAAAGYNLNRSSSDKFED 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 3/23 (13%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 5/20 (25%)
C2H2 Zn finger 144..165 CDD:275368 8/25 (32%)
C2H2 Zn finger 175..195 CDD:275368 6/19 (32%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 2/28 (7%)
AT1G14580NP_001320583.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_154965
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.