| Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001288708.1 | Gene: | ZNF202 / 7753 | HGNCID: | 12994 | Length: | 648 | Species: | Homo sapiens |
| Alignment Length: | 344 | Identity: | 80/344 - (23%) |
|---|---|---|---|
| Similarity: | 117/344 - (34%) | Gaps: | 114/344 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 KEAEILALLPHTY-----EDEELSLNTEELQFEE---------------------------LNER 39
Fly 40 -------------------------SQHQ---------------------QGGSPSFVCRRCPAL 58
Fly 59 FLTREELAAHRPTHRYQG-------------------GQQTPASE--HACDACGRVFQKHNALVD 102
Fly 103 HMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYL----HSCPEPGCKKRFQQRRECDQHV 163
Fly 164 KTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKA 228
Fly 229 YICSVCGADYMRRNQLIRH 247 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 5/19 (26%) |
| C2H2 Zn finger | 87..107 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 115..136 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 144..165 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 175..195 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 203..223 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 231..247 | CDD:275368 | 6/15 (40%) | ||
| ZNF202 | NP_001288708.1 | SCAN | 43..153 | CDD:128708 | |
| SCAN | 43..130 | CDD:280241 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..221 | ||||
| KRAB | 237..297 | CDD:214630 | |||
| KRAB | 237..277 | CDD:279668 | |||
| COG5048 | 397..>644 | CDD:227381 | 62/251 (25%) | ||
| C2H2 Zn finger | 399..419 | CDD:275368 | 0/19 (0%) | ||
| zf-H2C2_2 | 411..436 | CDD:290200 | 3/24 (13%) | ||
| C2H2 Zn finger | 427..447 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 483..503 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_2 | 495..520 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 511..531 | CDD:275368 | 6/24 (25%) | ||
| C2H2 Zn finger | 539..559 | CDD:275368 | 8/22 (36%) | ||
| C2H2 Zn finger | 567..587 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 593..615 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 595..615 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 607..632 | CDD:290200 | 6/24 (25%) | ||
| C2H2 Zn finger | 623..643 | CDD:275368 | 8/17 (47%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S4885 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||