DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and ZNF319

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001371294.1 Gene:ZNF319 / 57567 HGNCID:13644 Length:582 Species:Homo sapiens


Alignment Length:310 Identity:75/310 - (24%)
Similarity:120/310 - (38%) Gaps:54/310 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVQYKEAEIL-----------------ALLPHTYEDEELSLNTEELQFEELNERSQHQQ--GGSP 48
            |..||.||..                 .:.|....|:..|....:..|:.|:|.|:|::  .|..
Human   164 EKTYKPAEAAEPATTAAPSLPAAPAPSTVTPAEQADKPYSCPICQKPFKHLSELSRHERIHTGEK 228

  Fly    49 SFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRN- 112
            .:.|..|...|.....|..|:.||    ..:.|   :.|..|.:.|:..:.||.||.||:...: 
Human   229 PYKCTLCDKSFSQSSHLVHHKRTH----SSERP---YKCAVCEKTFKHRSHLVRHMYAHSGEHHL 286

  Fly   113 YPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPG--------CKKRFQQRRECDQHVKTVHQN 169
            :.|..|...|.:.|           ::..|.|...|        |:|.|::..:..||.:| |..
Human   287 FRCNVCELHFKESS-----------ELLQHPCTPSGERPFRCGECQKAFKRPSDLRQHERT-HSA 339

  Fly   170 ERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVC 234
            ||...||.|...|.......:|..:|.:.:.:.|.:|.|.||:|.:...|..||::...:.|.||
Human   340 ERPFKCDLCPMGFKQQYALMRHRRTHKTEEPFKCGLCEKGFGQPSHLLYHQHVHTLETLFKCPVC 404

  Fly   235 GADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAKNRSQRSAIDESQ 284
            ...:.:..:|:||....|....|       |...:..|...:.||:.:.|
Human   405 QKGFDQSAELLRHKCLPGAAERP-------FKCPVCNKAYKRASALQKHQ 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 7/28 (25%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
ZNF319NP_001371294.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
C2H2 Zn finger 78..98 CDD:275368
C2H2 Zn finger 106..126 CDD:275368
C2H2 Zn finger 134..154 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..198 1/23 (4%)
COG5048 <192..349 CDD:227381 44/175 (25%)
C2H2 Zn finger 204..224 CDD:275368 5/19 (26%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
C2H2 Zn finger 260..280 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..309 CDD:275368 6/30 (20%)
C2H2 Zn finger 317..337 CDD:275368 6/20 (30%)
C2H2 Zn finger 345..365 CDD:275368 5/19 (26%)
SFP1 <366..446 CDD:227516 21/86 (24%)
C2H2 Zn finger 373..393 CDD:275368 7/19 (37%)
C2H2 Zn finger 401..417 CDD:275368 4/15 (27%)
SFP1 <425..505 CDD:227516 6/30 (20%)
C2H2 Zn finger 430..450 CDD:275368 4/18 (22%)
C2H2 Zn finger 460..480 CDD:275368
C2H2 Zn finger 488..508 CDD:275368
zf-H2C2_2 500..525 CDD:404364
C2H2 Zn finger 516..536 CDD:275368
C2H2 Zn finger 544..564 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.