DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and LOC557537

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_009301868.1 Gene:LOC557537 / 557537 -ID:- Length:393 Species:Danio rerio


Alignment Length:279 Identity:76/279 - (27%)
Similarity:117/279 - (41%) Gaps:52/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEAEILALLPHTYEDEE-------LSLNTEELQF-----EELNERSQHQQG-GSPSFVCRRCPAL 58
            :|.|:|      .|.||       |...|||..|     |:.:.:.:.|:. |..||:|::|...
Zfish    36 EETEVL------IEVEENDQYKNHLGFKTEEASFSCSDTEKTSSQKRTQRSRGEKSFICQQCGKS 94

  Fly    59 FLTREELAAHRPTH-------------------------RYQGGQQTPASEHACDACGRVFQKHN 98
            |..|::|..|...|                         |...|::    ...|:.||:.|::..
Zfish    95 FRQRKQLKIHTRIHTGEKPYSCQECGKSFSQSSARKVHMRIHSGEK----PFTCEQCGKSFRQKK 155

  Fly    99 ALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHV 163
            .||.|...|...:.|.|..|...|.|.:..|.|:: :|......:|.|  |.|.|..:.....|:
Zfish   156 NLVGHRRIHTGEKPYTCTLCGKSFSQVAGLEIHMR-IHTGEKPFTCQE--CGKSFNSKETLKCHM 217

  Fly   164 KTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKA 228
             |||..|:...|..|...|:..|:::||:..|.|.:.:.|..|||.|.:.|:..||:.|||..|.
Zfish   218 -TVHSGEKIFTCKPCGISFTQKVSFKKHVLVHNSEQPFTCSQCGKSFDQEEHLKVHIRVHSKEKR 281

  Fly   229 YICSVCGADYMRRNQLIRH 247
            :.||.||..:..:.:...|
Zfish   282 FTCSTCGKGFYDKQRFEDH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 6/19 (32%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
LOC557537XP_009301868.1 COG5048 62..>379 CDD:227381 66/247 (27%)
C2H2 Zn finger 88..108 CDD:275368 6/19 (32%)
zf-H2C2_2 101..125 CDD:290200 3/23 (13%)
C2H2 Zn finger 116..136 CDD:275368 1/19 (5%)
zf-H2C2_2 130..153 CDD:290200 6/26 (23%)
C2H2 Zn finger 144..164 CDD:275368 7/19 (37%)
zf-H2C2_2 156..181 CDD:290200 8/24 (33%)
C2H2 Zn finger 172..192 CDD:275368 6/20 (30%)
zf-H2C2_2 185..209 CDD:290200 8/26 (31%)
C2H2 Zn finger 200..220 CDD:275368 7/22 (32%)
C2H2 Zn finger 228..248 CDD:275368 6/19 (32%)
C2H2 Zn finger 256..276 CDD:275368 8/19 (42%)
FYDLN_acid 280..>319 CDD:302856 6/21 (29%)
C2H2 Zn finger 284..304 CDD:275368 5/17 (29%)
zf-C2H2 310..332 CDD:278523
C2H2 Zn finger 312..332 CDD:275368
C2H2 Zn finger 340..360 CDD:275368
zf-H2C2_2 352..377 CDD:290200
C2H2 Zn finger 368..387 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.