Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303451.1 | Gene: | Sry-beta / 43570 | FlyBaseID: | FBgn0003511 | Length: | 356 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 52/200 - (26%) |
---|---|---|---|
Similarity: | 77/200 - (38%) | Gaps: | 13/200 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 EELQFEELNERSQHQQ----GGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDA 89
Fly 90 CGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQ 154
Fly 155 QRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAK-SYGCPICGKLFGRPENRDV 218
Fly 219 HLFVH 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 6/19 (32%) |
C2H2 Zn finger | 87..107 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 115..136 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 144..165 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 231..247 | CDD:275368 | |||
Sry-beta | NP_001303451.1 | C2H2 Zn finger | 203..223 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 231..251 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 259..308 | CDD:275368 | 13/50 (26%) | ||
C2H2 Zn finger | 288..303 | CDD:275370 | 4/14 (29%) | ||
zf-C2H2 | 315..337 | CDD:278523 | 8/21 (38%) | ||
C2H2 Zn finger | 317..337 | CDD:275368 | 7/19 (37%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45449832 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |