DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and Sry-beta

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001303451.1 Gene:Sry-beta / 43570 FlyBaseID:FBgn0003511 Length:356 Species:Drosophila melanogaster


Alignment Length:200 Identity:52/200 - (26%)
Similarity:77/200 - (38%) Gaps:13/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EELQFEELNERSQHQQ----GGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDA 89
            ||.||.|.::.....:    ..:....|..|..:|.::|.|..|......|..:|.     .|:.
  Fly   146 EEFQFSEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQA-----TCNV 205

  Fly    90 CGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQ 154
            ||...:....|..|||.|.......|..|..:|..:.|...|:: ||.....:.|.:  |.:||.
  Fly   206 CGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHME-VHWDKKKYQCDK--CGERFS 267

  Fly   155 QRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAK-SYGCPICGKLFGRPENRDV 218
            .......|:......|..|:|:.|..:|.....|:.||.:|.:.: .|.||.|.|.|.......|
  Fly   268 LSWLMYNHLMRHDAEENALICEVCHQQFKTKRTYKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKV 332

  Fly   219 HLFVH 223
            |..||
  Fly   333 HKRVH 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 5/20 (25%)
C2H2 Zn finger 144..165 CDD:275368 5/20 (25%)
C2H2 Zn finger 175..195 CDD:275368 6/19 (32%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368
Sry-betaNP_001303451.1 C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..251 CDD:275368 5/20 (25%)
C2H2 Zn finger 259..308 CDD:275368 13/50 (26%)
C2H2 Zn finger 288..303 CDD:275370 4/14 (29%)
zf-C2H2 315..337 CDD:278523 8/21 (38%)
C2H2 Zn finger 317..337 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449832
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.