DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG4424

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_650859.3 Gene:CG4424 / 42390 FlyBaseID:FBgn0038765 Length:345 Species:Drosophila melanogaster


Alignment Length:211 Identity:53/211 - (25%)
Similarity:74/211 - (35%) Gaps:54/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LTREELAAHRPTHRYQGGQQTPASE-------------HACDACGRVFQKHNALVDHMNAHNDVR 111
            ||.|.|.|..|         .|||.             |.|..||..:.:.:.|..||..|||.|
  Fly   158 LTVEMLPAPYP---------PPASTPPPAPAGAVKGKLHVCAICGNGYPRKSTLDTHMRRHNDER 213

  Fly   112 NYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCD 176
            .|               ||.:                |.|.|....:..:|::. |...:...|.
  Fly   214 PY---------------ECEI----------------CHKSFHVNYQLKRHIRQ-HTGAKPYTCQ 246

  Fly   177 TCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRR 241
            .|...|:...:..||..:|.:.:.|.|..|||.|.......:|...|:..|.:||.:|...:.|.
  Fly   247 YCQRNFADRTSLVKHERTHRNERPYACKTCGKKFTYASVLKMHYKTHTGEKPHICQLCNKSFARI 311

  Fly   242 NQLIRHGLASGHHNDP 257
            :.|:.|.....|.|||
  Fly   312 HNLVAHLQTQQHINDP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/11 (55%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 2/20 (10%)
C2H2 Zn finger 144..165 CDD:275368 4/20 (20%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 6/19 (32%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
CG4424NP_650859.3 zf-AD 10..92 CDD:285071
C2H2 Zn finger 189..209 CDD:275368 6/19 (32%)
DUF45 <204..281 CDD:302795 25/108 (23%)
COG5048 210..>345 CDD:227381 36/150 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/36 (14%)
C2H2 Zn finger 245..265 CDD:275368 5/19 (26%)
zf-H2C2_2 257..282 CDD:290200 9/24 (38%)
C2H2 Zn finger 273..293 CDD:275368 6/19 (32%)
zf-H2C2_2 286..310 CDD:290200 6/23 (26%)
C2H2 Zn finger 301..320 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.