Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650092.4 | Gene: | CG14710 / 41393 | FlyBaseID: | FBgn0037920 | Length: | 415 | Species: | Drosophila melanogaster |
Alignment Length: | 240 | Identity: | 59/240 - (24%) |
---|---|---|---|
Similarity: | 82/240 - (34%) | Gaps: | 69/240 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 EVQYKEAEIL---ALLPH-------------TYEDEELSLNTEELQFEELNERSQHQQGGSP--- 48
Fly 49 ---SFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDV 110
Fly 111 RNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVC 175
Fly 176 DTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHL 220 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 5/19 (26%) |
C2H2 Zn finger | 87..107 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 115..136 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 144..165 | CDD:275368 | 0/20 (0%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 7/18 (39%) | ||
C2H2 Zn finger | 231..247 | CDD:275368 | |||
CG14710 | NP_650092.4 | zf-AD | 9..83 | CDD:285071 | |
COG5048 | <261..395 | CDD:227381 | 45/172 (26%) | ||
C2H2 Zn finger | 264..284 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 290..312 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 292..312 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 304..327 | CDD:290200 | 7/22 (32%) | ||
C2H2 Zn finger | 320..340 | CDD:275368 | 7/51 (14%) | ||
zf-H2C2_2 | 335..357 | CDD:290200 | 8/53 (15%) | ||
C2H2 Zn finger | 348..368 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 376..395 | CDD:275368 | 7/18 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45446605 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |