DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG14710

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:240 Identity:59/240 - (24%)
Similarity:82/240 - (34%) Gaps:69/240 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVQYKEAEIL---ALLPH-------------TYEDEELSLNTEELQFEELNERSQHQQGGSP--- 48
            ||:|.:.|:|   |..||             ...|.||....:::..:|        :|..|   
  Fly   201 EVEYGDEELLMSSAPSPHPSFKMDKQKPGRPRKPDAELKFKRKDINAKE--------RGNQPKCK 257

  Fly    49 ---SFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDV 110
               .|:|..|..:|..:....||..||    .:..|   |.|:.|.:.|::...|..|:..|...
  Fly   258 EEEKFMCILCGNVFYKKSVFTAHMMTH----SEYKP---HQCEICNKSFRQMGELRAHIRRHTGD 315

  Fly   111 RNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVC 175
            |.|.|..|...|..||.|..|                                :.||.|.|...|
  Fly   316 RPYKCMYCDRHFYDRSERVRH--------------------------------ERVHTNTRPYAC 348

  Fly   176 DTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHL 220
            ..|...|:|....:.|:.||.:.|:|.|.||.|.|........||
  Fly   349 QECGKTFTHTAILKNHILSHSAQKNYNCGICCKSFTLLHQLKAHL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 5/19 (26%)
C2H2 Zn finger 115..136 CDD:275368 7/20 (35%)
C2H2 Zn finger 144..165 CDD:275368 0/20 (0%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 7/18 (39%)
C2H2 Zn finger 231..247 CDD:275368
CG14710NP_650092.4 zf-AD 9..83 CDD:285071
COG5048 <261..395 CDD:227381 45/172 (26%)
C2H2 Zn finger 264..284 CDD:275368 5/19 (26%)
zf-C2H2 290..312 CDD:278523 6/21 (29%)
C2H2 Zn finger 292..312 CDD:275368 5/19 (26%)
zf-H2C2_2 304..327 CDD:290200 7/22 (32%)
C2H2 Zn finger 320..340 CDD:275368 7/51 (14%)
zf-H2C2_2 335..357 CDD:290200 8/53 (15%)
C2H2 Zn finger 348..368 CDD:275368 5/19 (26%)
C2H2 Zn finger 376..395 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446605
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.