DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG6791

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_650090.1 Gene:CG6791 / 41391 FlyBaseID:FBgn0037918 Length:1243 Species:Drosophila melanogaster


Alignment Length:363 Identity:71/363 - (19%)
Similarity:109/363 - (30%) Gaps:126/363 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQYKEAEILALLPHTYEDEELSLNTEELQFEELNER--------------------SQHQQGGSP 48
            ::.|......::.|:..|      ..:|.||.:|||                    .||:....|
  Fly   524 IEKKHWRTHVVMAHSMND------LSKLNFEMINERQLKCTECDKIITNAYGIQNAQQHRITHLP 582

  Fly    49 SFV---CRRCPALFLTREELAAHRPTHRYQGGQQ-----------TPASE--------------- 84
            ...   ||:|...:..|:.|..|..||...|..:           |||.:               
  Fly   583 FKAYARCRKCHKSYTDRKGLVKHLATHHRVGWPRKLSGGCPAPILTPAKQPRKQIVTVANETYEI 647

  Fly    85 -HACDACGRVFQKHNALVDHMNAHNDV----------------------RNYPCPECPARFVQRS 126
             :..|......::.|...:.|.|..|.                      :.|.|..|...|..::
  Fly   648 IYLDDVDQGGMEEDNDFGEQMQAEEDEYPIAPPPPSPPPPPQPTTQGNHQRYKCVHCGTLFATQA 712

  Fly   127 NRECHLKNVHRKVYLHSCPEPGCKKRFQQRR------ECDQHVKTVHQNERNLVCDTCSARFSHP 185
            ....|:.            |..|:|...:||      ..|..|.||.|| ...:|.:|...:...
  Fly   713 AVRVHIS------------EKRCRKTVVRRRRQPVMSSADPSVPTVEQN-YIFLCPSCGFEYKTQ 764

  Fly   186 VNYRKHLAS-HGSAK------------SYGCPIC------GKLFGRPENRDVHLFVHSICKAYI- 230
            ..:|:|:.. |...|            .|.|..|      .||.|..:    |.|.|...:.|: 
  Fly   765 FEWRRHINEVHNFDKRQYLNMRQLDKYRYQCTQCKDIVCNSKLKGLQD----HHFRHLPYRLYLK 825

  Fly   231 CSVCGADYMRRNQLIRHGLASGH----HNDPIVRQKPQ 264
            |.:||..|..:..:..| |.:.|    ...|.:..||:
  Fly   826 CLICGTCYNHKPNIAAH-LRARHSIFDRETPTMITKPK 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
C2H2 Zn finger 87..107 CDD:275368 3/19 (16%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 7/26 (27%)
C2H2 Zn finger 175..195 CDD:275368 4/20 (20%)
C2H2 Zn finger 203..223 CDD:275368 7/25 (28%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
CG6791NP_650090.1 C2H2 Zn finger 167..188 CDD:275368
C2H2 Zn finger 208..230 CDD:275368
C2H2 Zn finger 235..256 CDD:275368
C2H2 Zn finger 516..532 CDD:275368 1/7 (14%)
C2H2 Zn finger 557..580 CDD:275368 2/22 (9%)
C2H2 Zn finger 589..609 CDD:275368 6/19 (32%)
COG5236 <939..>1096 CDD:227561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.