DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and topi

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:379 Identity:93/379 - (24%)
Similarity:143/379 - (37%) Gaps:67/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYKEAEILALLPHT---YEDEELSLNTEELQFEELNERSQHQQGG---------------SPSFV 51
            :|..|:|..||.|:   ..:........::|.....|.|.|.|..               |..||
  Fly   366 EYIFADIAELLVHSASHVAERRFECTACDIQMNTAKEASIHFQTDCIFMREAIRSLNVTLSRYFV 430

  Fly    52 CRRCPALFLTREELAAHRPT--HRY----QGGQQ--TPASEHACDACGRVFQ-KHNALV----DH 103
            |..|...|...:.|..||.|  |.:    :.|::  .|     ||.|...|: .|:.|.    .|
  Fly   431 CNVCELKFANTDLLQEHRCTSFHYFPRLNENGKKLLLP-----CDFCDVNFEFAHDFLAHSEEKH 490

  Fly   104 MN-----------AHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRR 157
            :|           ....:|.|.|..|...:.|.|:...||: .|:.|....|.|..|.::|..|.
  Fly   491 LNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQHLR-FHQGVKPFVCQEENCDRKFTIRP 554

  Fly   158 ECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFV 222
            :.:.|::..|..||..:|..|..||.....:.:|...|...:.|.|..|||.|.|.:....|..:
  Fly   555 DLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRGERRYECEECGKRFYRADALKNHQRI 619

  Fly   223 HSICKAYICSVCGADYMRRNQLIRHGLASGHH---NDPIVRQKPQFSPALAAKNRSQRSAIDESQ 284
            |:..|.|.|..|...:.:|....:|..|...|   |..::.|..:|....||..::| |...|.|
  Fly   620 HTGEKPYSCLFCTKTFRQRGDRDKHIRARHSHLDANSRLMMQMQKFQLETAAAQKAQ-SHNPEQQ 683

  Fly   285 DEELQWLKGVDALD---SAGYLENS------QFSNT----GKMTAIFAEDENES 325
            |.::  ..|....|   .:|::...      |:|.|    .:|..:..::.|.|
  Fly   684 DNDV--AGGASTSDVPSGSGFMSTEPSVAEMQYSITPEQQEEMVCVPIDEVNNS 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/21 (33%)
C2H2 Zn finger 87..107 CDD:275368 8/35 (23%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 5/19 (26%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368
C2H2 Zn finger 431..453 CDD:275368 7/21 (33%)
COG5048 <450..647 CDD:227381 52/202 (26%)
C2H2 Zn finger 469..490 CDD:275368 6/20 (30%)
zf-C2H2 511..533 CDD:278523 7/22 (32%)
C2H2 Zn finger 513..564 CDD:275368 14/51 (27%)
C2H2 Zn finger 541..561 CDD:275368 6/19 (32%)
zf-H2C2_2 555..581 CDD:290200 8/25 (32%)
C2H2 Zn finger 572..592 CDD:275368 5/19 (26%)
zf-H2C2_2 585..609 CDD:290200 8/23 (35%)
zf-C2H2 598..620 CDD:278523 8/21 (38%)
C2H2 Zn finger 600..620 CDD:275368 7/19 (37%)
zf-H2C2_2 612..637 CDD:290200 6/24 (25%)
C2H2 Zn finger 628..646 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.