| Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649920.2 | Gene: | CG8319 / 41165 | FlyBaseID: | FBgn0037722 | Length: | 383 | Species: | Drosophila melanogaster |
| Alignment Length: | 230 | Identity: | 65/230 - (28%) |
|---|---|---|---|
| Similarity: | 91/230 - (39%) | Gaps: | 18/230 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 QFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQK 96
Fly 97 HNALVDHMNAHNDVRN-YPCPECPARFVQRSNRECHLKNVHRKVYL----HSCPEPGCKKRFQQR 156
Fly 157 RECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLF 221
Fly 222 VHSICKAYICSVCGADYMRRNQLIRHGLASGHHND 256 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 6/19 (32%) |
| C2H2 Zn finger | 87..107 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 115..136 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 144..165 | CDD:275368 | 4/20 (20%) | ||
| C2H2 Zn finger | 175..195 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 203..223 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 231..247 | CDD:275368 | 5/15 (33%) | ||
| CG8319 | NP_649920.2 | zf-AD | 4..79 | CDD:285071 | |
| COG5048 | <153..368 | CDD:227381 | 59/219 (27%) | ||
| C2H2 Zn finger | 153..173 | CDD:275368 | 3/13 (23%) | ||
| C2H2 Zn finger | 179..196 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 207..227 | CDD:275370 | 6/19 (32%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 4/22 (18%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 308..332 | CDD:290200 | 8/23 (35%) | ||
| zf-C2H2 | 322..344 | CDD:278523 | 8/21 (38%) | ||
| C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 352..368 | CDD:275368 | 5/15 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45449822 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||