DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG1024

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001138014.2 Gene:CG1024 / 40789 FlyBaseID:FBgn0027514 Length:543 Species:Drosophila melanogaster


Alignment Length:291 Identity:64/291 - (21%)
Similarity:92/291 - (31%) Gaps:104/291 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQYKEAEILALLPHTYEDEELSLNTEELQFE--------ELNERSQ----HQQGGSPSFVCRRCP 56
            |:.:|.|::.    .|:||..:|..|  .|:        |.||..|    |.|.|:...|.....
  Fly   232 VRKEEKEVVP----KYDDELDALCKE--FFDDGPSAGKGEANEEQQQDDAHLQQGNQEVVIIEID 290

  Fly    57 ALFLTREELA----------AHRPTHRYQGGQQTPASE---------------HACDACGR---- 92
            |  |.:||:|          ..:||.| :....||:.:               :.|..||:    
  Fly   291 A--LGKEEVAQLKKEMKSDPISQPTKR-RRISTTPSRDSDTEMSTNGLTKLISYLCPKCGKEIAS 352

  Fly    93 -------VFQKH---------------------------------NALVDHMNAHNDVRNY-PCP 116
                   ||:||                                 :.|..|...|...|:| .|.
  Fly   353 MDGWRAHVFKKHDFEHIIENSFKILESGRKAMCLQCREVQPTTVRSQLQKHCFKHLPYRSYLKCT 417

  Fly   117 ECPARFVQRSNRECHLKNVHR-------KVYLHSCPEP--GCKKRFQQRRECDQHVKTVHQNERN 172
            .|.......|....|::..|:       |..|...|||  ....:..|....|.......|.|: 
  Fly   418 LCDRTKTSTSKILNHIRYNHQEELQRKNKTQLLIKPEPMWASPNKSGQAAMADDAGSEDDQGEQ- 481

  Fly   173 LVCDTCSARFSHPVNYRKHLAS---HGSAKS 200
            .||:.|...|.....|.:|:||   .|:.||
  Fly   482 AVCEHCDRVFRSKWRYERHIASCRRSGAGKS 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/29 (21%)
C2H2 Zn finger 87..107 CDD:275368 9/63 (14%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 5/22 (23%)
C2H2 Zn finger 175..195 CDD:275368 7/22 (32%)
C2H2 Zn finger 203..223 CDD:275368
C2H2 Zn finger 231..247 CDD:275368
CG1024NP_001138014.2 C2H2 Zn finger 30..51 CDD:275368
C2H2 Zn finger 73..100 CDD:275368
C2H2 Zn finger 106..123 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.