DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG11247

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:234 Identity:53/234 - (22%)
Similarity:94/234 - (40%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PHTYEDEELSLNTEELQFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQT 80
            ||..:|...|..........:....:|::    .|||.:||..|..:|.|..|...|   .|:: 
  Fly   120 PHKCKDCGKSYRQAVNLKNHITTAHEHRK----QFVCSQCPKSFALKERLRLHMRLH---SGEK- 176

  Fly    81 PASEHACDACGRVFQKHNALVDHMNAHN--DVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHS 143
               .:.||.|.:.|.:...|..||.:|:  .::.:.|.:|.|.|...:|...|::. |.:...|.
  Fly   177 ---PYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMER-HEQGMEHR 237

  Fly   144 CPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGK 208
            |..  |:.:|........|:...|.......|:.|........:...|:..|.:.|::.|.:|..
  Fly   238 CSI--CENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTAVKTHVCEVCNT 300

  Fly   209 LFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRH 247
            .|.:....:||:.:|:..:.|.|.:|...:...:.|..|
  Fly   301 YFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLH 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/19 (37%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 4/20 (20%)
C2H2 Zn finger 175..195 CDD:275368 3/19 (16%)
C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 35/140 (25%)
C2H2 Zn finger 95..115 CDD:275368
zf-H2C2_2 107..132 CDD:290200 4/11 (36%)
C2H2 Zn finger 123..144 CDD:275368 2/20 (10%)
C2H2 Zn finger 152..172 CDD:275368 7/19 (37%)
zf-H2C2_2 165..189 CDD:290200 8/30 (27%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
COG5048 <192..369 CDD:227381 33/151 (22%)
C2H2 Zn finger 210..230 CDD:275370 6/20 (30%)
C2H2 Zn finger 238..260 CDD:275371 4/23 (17%)
C2H2 Zn finger 267..287 CDD:275368 3/19 (16%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
zf-H2C2_2 309..332 CDD:290200 6/22 (27%)
C2H2 Zn finger 323..343 CDD:275368 4/17 (24%)
C2H2 Zn finger 351..374 CDD:275368
C2H2 Zn finger 382..399 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.