Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001097659.1 | Gene: | CG11247 / 40414 | FlyBaseID: | FBgn0037120 | Length: | 522 | Species: | Drosophila melanogaster |
Alignment Length: | 234 | Identity: | 53/234 - (22%) |
---|---|---|---|
Similarity: | 94/234 - (40%) | Gaps: | 16/234 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 PHTYEDEELSLNTEELQFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQT 80
Fly 81 PASEHACDACGRVFQKHNALVDHMNAHN--DVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHS 143
Fly 144 CPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGK 208
Fly 209 LFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRH 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 7/19 (37%) |
C2H2 Zn finger | 87..107 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 115..136 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 144..165 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 231..247 | CDD:275368 | 3/15 (20%) | ||
CG11247 | NP_001097659.1 | COG5048 | <88..247 | CDD:227381 | 35/140 (25%) |
C2H2 Zn finger | 95..115 | CDD:275368 | |||
zf-H2C2_2 | 107..132 | CDD:290200 | 4/11 (36%) | ||
C2H2 Zn finger | 123..144 | CDD:275368 | 2/20 (10%) | ||
C2H2 Zn finger | 152..172 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 165..189 | CDD:290200 | 8/30 (27%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 7/19 (37%) | ||
COG5048 | <192..369 | CDD:227381 | 33/151 (22%) | ||
C2H2 Zn finger | 210..230 | CDD:275370 | 6/20 (30%) | ||
C2H2 Zn finger | 238..260 | CDD:275371 | 4/23 (17%) | ||
C2H2 Zn finger | 267..287 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 295..315 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 309..332 | CDD:290200 | 6/22 (27%) | ||
C2H2 Zn finger | 323..343 | CDD:275368 | 4/17 (24%) | ||
C2H2 Zn finger | 351..374 | CDD:275368 | |||
C2H2 Zn finger | 382..399 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45446606 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |