| Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_649316.1 | Gene: | Neu2 / 40375 | FlyBaseID: | FBgn0037085 | Length: | 382 | Species: | Drosophila melanogaster |
| Alignment Length: | 245 | Identity: | 63/245 - (25%) |
|---|---|---|---|
| Similarity: | 90/245 - (36%) | Gaps: | 28/245 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 48 PSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRN 112
Fly 113 YPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDT 177
Fly 178 CSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSIC---------------K 227
Fly 228 AYICSVCGADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAKNRSQR 277 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 6/19 (32%) |
| C2H2 Zn finger | 87..107 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 115..136 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 144..165 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 175..195 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 203..223 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 231..247 | CDD:275368 | 4/15 (27%) | ||
| Neu2 | NP_649316.1 | zf-AD | 1..63 | CDD:285071 | |
| COG5048 | <119..241 | CDD:227381 | 37/132 (28%) | ||
| C2H2 Zn finger | 121..141 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 133..158 | CDD:290200 | 7/31 (23%) | ||
| C2H2 Zn finger | 149..169 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 162..185 | CDD:290200 | 8/22 (36%) | ||
| C2H2 Zn finger | 177..197 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 205..225 | CDD:275368 | 8/22 (36%) | ||
| zf-C2H2_8 | 206..286 | CDD:292531 | 22/83 (27%) | ||
| C2H2 Zn finger | 233..253 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 260..297 | CDD:275368 | 7/36 (19%) | ||
| C2H2 Zn finger | 303..323 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 353..373 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446561 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR24409 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.030 | |||||