DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG10543

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001369100.1 Gene:CG10543 / 37379 FlyBaseID:FBgn0034570 Length:1666 Species:Drosophila melanogaster


Alignment Length:434 Identity:89/434 - (20%)
Similarity:158/434 - (36%) Gaps:127/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EDEELSLNTEELQF--EELNE------------RSQHQQG---------GS----PSFVCRRCPA 57
            :|::|..:.:||..  ::|.:            .|||..|         ||    ||:.|..||.
  Fly   668 DDDDLDHDLDELDAAKQQLIDGGSSSSTSLQAPPSQHGSGSGGSGGQTPGSKKDKPSYNCLLCPK 732

  Fly    58 LFLTREELAAH---RPTHRYQGGQQTPAS-----EH-----------ACDACGRVFQKHNALVDH 103
            .:..|:.|..|   .|.:.:..||:...:     .|           .|:.||..:.:......|
  Fly   733 SYRKRKSLLDHYKMHPGYCHDCGQRNGNTLEEIIHHNRTMHVKEFPFVCETCGESYSRKQQFHAH 797

  Fly   104 MNAHN--DVRNYPCPECPARFVQRSNRE----------------C------------HLKNVHRK 138
            :.:||  :::.:||.||..:|.|:..::                |            |:..||::
  Fly   798 VESHNKKEIKTFPCGECGLKFPQKKLQQHFEETGHKADGAICEVCGEEFQSKNALYQHIIRVHKR 862

  Fly   139 VYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTC-SARFSHPVNYRKHLASHGSAKSYG 202
            .....|..  |..||..:...::||:...:.:|..|||.| |:.|::|.....:..:|.......
  Fly   863 DNFFECHI--CHNRFTLKANLERHVQLHTEIKRPYVCDLCGSSYFTYPALKEHYSNAHVDVSECK 925

  Fly   203 CPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLASGHHNDP---------- 257
            |.:|||.||..::...||..||..:.:.|:.|...:..:..|:|| ..:.|.|:|          
  Fly   926 CTLCGKRFGSAKSLQRHLPSHSEERPHCCNYCDQTFKWKTHLVRH-KQTMHGNEPPPPKKGKQRF 989

  Fly   258 ---------------------------IVRQKPQFSPALAAKNRSQR-----SAIDESQDEELQW 290
                                       ..:.|.|.:.|.||...||:     ||...:....:..
  Fly   990 PKTSEEDMGSLPDMPGPPPVKASKKAATSKAKAQAAAAAAAAASSQQQQQKGSAATPTPPPPVST 1054

  Fly   291 LKGV---DALDSAGYLENSQFSNTGKMT--AIFAEDENESELFN 329
            ..|.   |..::|....||..|:|...:  ::...:..::.::|
  Fly  1055 TPGCLQQDPFNAAMVSSNSSQSSTASTSQHSVSTSESQQNSIYN 1098

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/22 (32%)
C2H2 Zn finger 87..107 CDD:275368 4/19 (21%)
C2H2 Zn finger 115..136 CDD:275368 7/48 (15%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 6/20 (30%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
CG10543NP_001369100.1 C2H2 Zn finger 727..747 CDD:275368 6/19 (32%)
C2H2 Zn finger 751..773 CDD:275368 3/21 (14%)
C2H2 Zn finger 781..801 CDD:275368 4/19 (21%)
PHA00733 <804..860 CDD:177301 8/55 (15%)
C2H2 Zn finger 811..827 CDD:275368 5/15 (33%)
C2H2 Zn finger 839..860 CDD:275368 2/20 (10%)
C2H2 Zn finger 868..888 CDD:275368 6/21 (29%)
C2H2 Zn finger 897..913 CDD:275368 6/15 (40%)
C2H2 Zn finger 926..946 CDD:275368 8/19 (42%)
C2H2 Zn finger 954..975 CDD:275368 5/21 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.