DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG17385

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:288 Identity:80/288 - (27%)
Similarity:108/288 - (37%) Gaps:48/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELQFEE--LNERSQHQQGGSPSFVCRRCPALFLTREELAAHR-PTHRYQGGQQTPASEHACDACG 91
            |::|:|  .|:           |.|:||...|.::.:...|| ..|.:.      .:.:.|..|.
  Fly     5 EVEFDETVANQ-----------FSCKRCDRTFRSKRDQTLHRQEVHNHN------KTTYECKLCA 52

  Fly    92 RVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEP----GCKKR 152
            :.|.....|..||..|||||.:.|..|...|.|..|.:.|..       :||...|    .|.|.
  Fly    53 KSFCNSGNLDRHMKVHNDVRPFVCNICSKAFAQAVNLQRHYA-------VHSGERPFTCNFCNKS 110

  Fly   153 FQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRD 217
            |.|:....:| |..|..|:...|..|...||..||.:||...|.:||.|.|..|.|.|.:..|..
  Fly   111 FTQQSNMKRH-KMTHTGEKPFRCQRCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFK 174

  Fly   218 VHLFVHSICKAYICSVCGADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAKNRSQRSAIDE 282
            .||..|  .|..:.....|.......|.|..|.|        .|||.|...:..     |:..|.
  Fly   175 RHLQSH--IKEGVDVDVPASIQAAAALARERLES--------EQKPSFFECMVC-----RAIFDT 224

  Fly   283 SQDEELQWLKGVDALDSAGYLENSQFSN 310
            ..|.|....|..:..:.| .||.:|.|:
  Fly   225 FADYEKHEAKCHEDHERA-QLEVNQMSH 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/20 (30%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 6/24 (25%)
C2H2 Zn finger 175..195 CDD:275368 8/19 (42%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 2/15 (13%)
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 57/194 (29%)
C2H2 Zn finger 18..39 CDD:275368 6/20 (30%)
C2H2 Zn finger 48..68 CDD:275368 6/19 (32%)
C2H2 Zn finger 76..96 CDD:275368 6/26 (23%)
C2H2 Zn finger 104..124 CDD:275368 6/20 (30%)
C2H2 Zn finger 132..148 CDD:275368 6/15 (40%)
C2H2 Zn finger 160..180 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.