DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and crol

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001245993.1 Gene:crol / 34592 FlyBaseID:FBgn0020309 Length:962 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:101/270 - (37%) Gaps:60/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELQFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVF 94
            :.:::.:..|..|.:  ...|:|:.|...|.|.::|..|...|  .||..     ..|..|..||
  Fly   231 QFRYQLIVHRRYHSE--RKPFMCQVCGQGFTTSQDLTRHGKIH--IGGPM-----FTCIVCFNVF 286

  Fly    95 QKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHL---------------KNVHRKVYL--- 141
            ..:.:|..||..|:..:.:.|..|...|.::.:.:.|.               |...||.::   
  Fly   287 ANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNH 351

  Fly   142 ---------HSCPEPGCKKRFQQRRECDQHV-----KTVHQNERNLVCDTCSARFSHPVNYRKHL 192
                     |.|..  |||.|.::.....|.     :|.||      ||.|..:::...:...|:
  Fly   352 VRKHTGETPHRCDI--CKKSFTRKEHYVNHYMWHTGQTPHQ------CDVCGKKYTRKEHLANHM 408

  Fly   193 ASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLASGHHNDP 257
            .||.:...:.|.||||.|.|.|:...|:..|:....:.|..|...:.|:..|:.|          
  Fly   409 RSHTNETPFRCEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNH---------- 463

  Fly   258 IVRQKPQFSP 267
             |||....||
  Fly   464 -VRQHTGESP 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 5/35 (14%)
C2H2 Zn finger 144..165 CDD:275368 6/25 (24%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
C2H2 Zn finger 203..223 CDD:275368 9/19 (47%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
crolNP_001245993.1 C2H2 Zn finger 223..243 CDD:275368 1/11 (9%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
C2H2 Zn finger 279..299 CDD:275368 7/19 (37%)
COG5048 300..723 CDD:227381 43/192 (22%)
C2H2 Zn finger 307..327 CDD:275368 4/19 (21%)
C2H2 Zn finger 335..355 CDD:275368 3/19 (16%)
C2H2 Zn finger 363..383 CDD:275368 6/21 (29%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
C2H2 Zn finger 419..439 CDD:275368 9/19 (47%)
C2H2 Zn finger 447..467 CDD:275368 7/30 (23%)
C2H2 Zn finger 475..495 CDD:275368
C2H2 Zn finger 503..523 CDD:275368
C2H2 Zn finger 531..551 CDD:275368
C2H2 Zn finger 559..579 CDD:275368
C2H2 Zn finger 587..607 CDD:275368
C2H2 Zn finger 615..636 CDD:275368
C2H2 Zn finger 644..664 CDD:275368
C2H2 Zn finger 676..696 CDD:275368
C2H2 Zn finger 704..722 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446604
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.