| Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_608840.1 | Gene: | CG15436 / 33657 | FlyBaseID: | FBgn0031610 | Length: | 346 | Species: | Drosophila melanogaster |
| Alignment Length: | 244 | Identity: | 60/244 - (24%) |
|---|---|---|---|
| Similarity: | 96/244 - (39%) | Gaps: | 34/244 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 21 DEELSLNTEELQFE--ELNERSQ-----------HQQGGSPSFVCRRCPALFLTREELAAHRPTH 72
Fly 73 RYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHR 137
Fly 138 KVYLHSCPEP----GCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSA 198
Fly 199 KSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRH 247 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 7/19 (37%) |
| C2H2 Zn finger | 87..107 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 115..136 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 144..165 | CDD:275368 | 6/24 (25%) | ||
| C2H2 Zn finger | 175..195 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 203..223 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 231..247 | CDD:275368 | 5/15 (33%) | ||
| CG15436 | NP_608840.1 | zf-AD | 4..78 | CDD:285071 | |
| C2H2 Zn finger | 128..148 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 156..176 | CDD:275368 | 7/19 (37%) | ||
| COG5048 | <180..341 | CDD:227381 | 41/169 (24%) | ||
| C2H2 Zn finger | 184..204 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 197..219 | CDD:290200 | 6/21 (29%) | ||
| C2H2 Zn finger | 212..232 | CDD:275368 | 5/26 (19%) | ||
| zf-H2C2_2 | 224..249 | CDD:290200 | 6/31 (19%) | ||
| C2H2 Zn finger | 240..260 | CDD:275368 | 5/20 (25%) | ||
| zf-H2C2_2 | 252..276 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 268..288 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 296..316 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 324..341 | CDD:275368 | 7/17 (41%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45446531 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||