DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG17612

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:272 Identity:71/272 - (26%)
Similarity:104/272 - (38%) Gaps:39/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PSFVCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRN 112
            |.:.|..||.|||....|..|..||.....:.:..|.|.|..|..||...::|.||:..|...|.
  Fly   355 PPYRCPHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSSLKDHVKIHAGERT 419

  Fly   113 YPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDT 177
            :.||.|...|.:.||.:.| ...|.:...|.     |.|.|:.:...|.|.|..|..:....|..
  Fly   420 FKCPLCLMSFQEESNLKSH-DCAHTRFKCHK-----CSKFFESQNYLDFHFKKSHTTKGPFKCIK 478

  Fly   178 CSARFSHPVNYRKHLASHG-----SAKSYG----CPICGKLFGRPENRDVHLFVHSICKAYI--- 230
            |...|......::|::|..     .:||.|    ||.|.|.|...:|..:|...|...|..|   
  Fly   479 CQQTFQKRNGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMHHATHKKVKTVIERH 543

  Fly   231 -CSVCGADYMRRNQLIRHGLASGHHNDPI----------------VRQKPQFSPALAAKNRS-QR 277
             |:.|...|..:..|.:|.|:   ||..:                ..|..|.:.:...||.: ..
  Fly   544 NCTQCKKSYQNKKLLTKHILS---HNRCVHCSMSFTSKYLLEQHTCSQSYQLNGSRGRKNPNLNY 605

  Fly   278 SAIDESQDEELQ 289
            :..:||.:.:|:
  Fly   606 NECEESNESDLE 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 8/19 (42%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 7/20 (35%)
C2H2 Zn finger 144..165 CDD:275368 5/20 (25%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071
C2H2 Zn finger 290..310 CDD:275368
C2H2 Zn finger 323..343 CDD:275370
zf-C2H2_8 356..438 CDD:292531 27/81 (33%)
C2H2 Zn finger 359..379 CDD:275368 8/19 (42%)
C2H2 Zn finger 394..414 CDD:275368 7/19 (37%)
C2H2 Zn finger 422..438 CDD:275368 6/15 (40%)
C2H2 Zn finger 447..463 CDD:275368 5/20 (25%)
C2H2 Zn finger 476..505 CDD:275368 5/28 (18%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
C2H2 Zn finger 545..565 CDD:275368 6/22 (27%)
C2H2 Zn finger 568..584 CDD:275368 0/15 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449814
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.