DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG1529

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster


Alignment Length:340 Identity:78/340 - (22%)
Similarity:130/340 - (38%) Gaps:64/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PHTYED--EELSLNT-----------------EELQFEELNERSQHQQGGSPSFVCRRCPALFLT 61
            |..||:  ::||..|                 .:|.:.|.:.||.| ||.|..|:||.|...|..
  Fly   147 PDEYENSQQQLSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVH-QGYSKPFLCRSCDKSFTR 210

  Fly    62 REELAAH-RPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPARFVQR 125
            .|:|.:| |..|......|....:..|:.|.|.:...|||.:|:..|...:.:.|..|....|.|
  Fly   211 YEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTR 275

  Fly   126 SNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARF----SHPV 186
            :....||:..:.......|.:  |.:.|:.:....:||:.||:.:|...|..|..:|    |...
  Fly   276 TELLTHLRTHNPTWERFKCEQ--CPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVR 338

  Fly   187 NYRKHLASHGSAKS-----YGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIR 246
            :.|.|..|.||.::     :.|..|.|.....:..::||..|...|.         :.:|.:..|
  Fly   339 HERLHTESTGSGEAAEEWPFACIHCQKPCVSRQTLELHLRRHRARKT---------HRKRREHSR 394

  Fly   247 HGLASGHHNDPIVRQKPQFSPALAAKNRSQRSAIDESQDEELQWLKGVDALDSAGYLENSQFSNT 311
            ........:|                 |.|.....|:|.::|:  ||    :.....:.|:.|:.
  Fly   395 ESQEQEQEHD-----------------RDQEQGAREAQQDQLR--KG----EKLRQRDLSRESHR 436

  Fly   312 GKMTAIFAEDENESE 326
            .::|...::..||.:
  Fly   437 NEVTMQTSQRPNECQ 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 8/20 (40%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 5/20 (25%)
C2H2 Zn finger 175..195 CDD:275368 6/23 (26%)
C2H2 Zn finger 203..223 CDD:275368 5/19 (26%)
C2H2 Zn finger 231..247 CDD:275368 1/15 (7%)
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 4/20 (20%)
zf-C2H2_2 201..>257 CDD:289522 17/55 (31%)
C2H2 Zn finger 201..222 CDD:275368 8/20 (40%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 6/19 (32%)
zf-C2H2_8 268..349 CDD:292531 20/82 (24%)
C2H2 Zn finger 294..315 CDD:275368 5/22 (23%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.