DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG9609

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:368 Identity:77/368 - (20%)
Similarity:128/368 - (34%) Gaps:91/368 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELQFEELNERSQHQQG-GSPSFVCR--RCPALFLTREELAAHRPTH--------RYQGGQQTPA- 82
            |...||..:|...:.. ||..:.|.  :|.|.|...::|..|...|        .|:|..:|.: 
  Fly    14 ETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEYHHTGIKKHACSYEGCDKTYSI 78

  Fly    83 ---------SEH-------------ACDACGRVFQKHNALVDHM-NAHNDVRNYPCPECPARFVQ 124
                     |.|             |.:.|.::|...:.:..|| ..|...:.|||.:|.|:|.|
  Fly    79 VTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSNMTRHMRETHESPKVYPCSQCSAKFSQ 143

  Fly   125 RSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHV-------------------------- 163
            :...:.|....|...|.:||.:  |.:.|.|:.:|..|.                          
  Fly   144 KLKLKRHEIREHTLEYPYSCSK--CSRGFYQQWQCQSHEPSCKLYECPGCPLQFDKWTLYTKHCR 206

  Fly   164 KTVHQNERNLVCDTCSARFSHPVNYRKHL-ASHGS-------AKSYGC--PICGKLFGRPENRDV 218
            .::|...|: .||.|.:.|..|...::|| ..|..       |.|:.|  ..|||.:....|...
  Fly   207 DSLHGKNRH-KCDRCDSAFDKPSELKRHLEVKHKEAAQTDECATSFTCNEEGCGKSYSYLRNLRQ 270

  Fly   219 HLFVHSICKAYICSV--CGADYMRRNQLIRHGLASGHHNDPIVRQKPQFSPALAAKNRSQRSAID 281
            |:......:.:.|..  ||..:.....|.||.|..  |.|...:::      |.||.:.:....:
  Fly   271 HMLTAHSGRRFECQALDCGRCFSSAQNLARHLLRD--HKDGATKKE------LKAKKKDKSKTGE 327

  Fly   282 ESQDEELQWLKGVDALDSAGYLENSQFSNTGKMTAIFAEDENE 324
            ..:.:.....:..||       ..|:.|...|:..:..:.|::
  Fly   328 GGKTKSTSRKRRRDA-------GRSKHSRLSKLACLQLDKEDD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/21 (29%)
C2H2 Zn finger 87..107 CDD:275368 4/20 (20%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 6/46 (13%)
C2H2 Zn finger 175..195 CDD:275368 7/20 (35%)
C2H2 Zn finger 203..223 CDD:275368 6/21 (29%)
C2H2 Zn finger 231..247 CDD:275368 4/17 (24%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 5/18 (28%)
zf-C2H2_8 67..150 CDD:292531 18/82 (22%)
C2H2 Zn finger 67..90 CDD:275368 4/22 (18%)
C2H2 Zn finger 106..126 CDD:275368 4/19 (21%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 0/21 (0%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 253..276 CDD:275368 6/22 (27%)
C2H2 Zn finger 283..302 CDD:275368 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.