DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG18262

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:271 Identity:69/271 - (25%)
Similarity:111/271 - (40%) Gaps:43/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NERSQHQQGGSPS-FVCRR--CPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHN 98
            :||:..::.|.|. :.|..  |...|.|..:|..||..|          :...||.||:.|.:..
  Fly   208 SERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKH----------TGIFCDICGKPFTQSG 262

  Fly    99 ALVDHMNAHNDVRNYPCPECPARFVQR----SNRECHLKNVHRKVYLHSCPEPGCKKRFQQRREC 159
            .::.|...|:.::.:.||||.|.|..:    |:..||...:       .|....|.:..:.|...
  Fly   263 NMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRM-------PCICEVCGRPCRDRGVL 320

  Fly   160 DQHVKTVHQNERNLVCDTCSARF--SHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFV 222
            ..|::. |..||...|:.|...|  .|.:|.  |..||.:.:.:.|.:||..|.|.:...||..:
  Fly   321 TAHMRR-HTGERPAKCEVCGKAFYSFHDLNV--HAVSHTNLRPFVCDVCGSTFQRKKALRVHKLL 382

  Fly   223 HSICKAYICSVCGADYMRRNQLIRHGLASGHHNDP-----IVRQKPQFSPALAAKNRSQRS---- 278
            ||..:.|.|.:||..:.:...|..|    ...:||     .|:..||.......:.:|..:    
  Fly   383 HSEQRKYACKLCGKTFAQSGGLNAH----MRSHDPARVKGAVKPLPQSVTIEVIEGKSPPTTTIT 443

  Fly   279 -AIDESQDEEL 288
             |||.:.:|:|
  Fly   444 MAIDLNVEEQL 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 7/21 (33%)
C2H2 Zn finger 87..107 CDD:275368 6/19 (32%)
C2H2 Zn finger 115..136 CDD:275368 9/24 (38%)
C2H2 Zn finger 144..165 CDD:275368 4/20 (20%)
C2H2 Zn finger 175..195 CDD:275368 6/21 (29%)
C2H2 Zn finger 203..223 CDD:275368 7/19 (37%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 44/172 (26%)
zf-H2C2_2 263..288 CDD:290200 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 13/55 (24%)
zf-H2C2_2 320..342 CDD:290200 6/22 (27%)
C2H2 Zn finger 335..355 CDD:275368 6/21 (29%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 6/25 (24%)
C2H2 Zn finger 391..411 CDD:275368 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449820
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.