DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG2120

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:246 Identity:62/246 - (25%)
Similarity:88/246 - (35%) Gaps:66/246 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QYKEAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQGGSPSFVCRRCPALFLTREELAAHR 69
            ::.||..|.:...|:.||:                         ..||..|...|....:|..|.
  Fly   107 RFSEAYNLRIHKMTHTDEK-------------------------PHVCVECGKGFRQLNKLRIHA 146

  Fly    70 PTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPC--PECPARFVQRSNRECHL 132
            .||       |....|.||.||:.|:..|.|..|...|...:.|||  .:|...|     ...|.
  Fly   147 VTH-------TAERPHKCDICGKGFRYANYLTVHRRLHTGEKPYPCLATDCHLSF-----HSIHA 199

  Fly   133 KNVHRKVYLHSC---PEPGCKKRFQQRRE----------C-----DQ-----HVKTVHQNERNLV 174
            :.:|.|: .|:.   |:|......|::|:          |     ||     |:|. |.|:|:..
  Fly   200 RRIHTKL-RHAAQTDPDPEHPLAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKR-HYNQRDFP 262

  Fly   175 C--DTCSARFSHPVNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVH 223
            |  ..|..||......:.|..:|...:.:.||:|...|.|..|...||.||
  Fly   263 CPQPECGKRFFSASELKHHQIAHTQQRPFACPLCPARFLRKSNHKQHLKVH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 8/19 (42%)
C2H2 Zn finger 115..136 CDD:275368 4/22 (18%)
C2H2 Zn finger 144..165 CDD:275368 8/43 (19%)
C2H2 Zn finger 175..195 CDD:275368 5/21 (24%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368 3/13 (23%)
zf-H2C2_2 113..138 CDD:290200 8/49 (16%)
C2H2 Zn finger 129..149 CDD:275368 5/19 (26%)
zf-H2C2_2 142..166 CDD:290200 11/30 (37%)
COG5048 151..>264 CDD:227381 31/119 (26%)
C2H2 Zn finger 157..177 CDD:275368 8/19 (42%)
C2H2 Zn finger 185..206 CDD:275368 5/25 (20%)
C2H2 Zn finger 235..255 CDD:275368 5/20 (25%)
C2H2 Zn finger 263..285 CDD:275368 5/21 (24%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446546
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.