DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and CG2116

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:NP_572444.2 Gene:CG2116 / 31735 FlyBaseID:FBgn0030003 Length:598 Species:Drosophila melanogaster


Alignment Length:323 Identity:70/323 - (21%)
Similarity:117/323 - (36%) Gaps:77/323 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 CRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCP 116
            |..||.: :.:.:|:.|..||...|     .:.:||..|...::....|..|...|..:|.|.|.
  Fly   256 CGICPDV-MHKSKLSKHHKTHLVPG-----TNRYACIYCTETYRDCKYLAGHARRHMGIRPYVCE 314

  Fly   117 ECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSAR 181
            .|...|..:.:...|.:..|.:.. |.|..  |.|.|.|..:..:|.:..|:.:|...|:.|...
  Fly   315 LCTLYFSTKQDLRVHNQRRHLEKE-HICEV--CGKTFAQNTQLKRHREATHEKKRRFQCEYCQKA 376

  Fly   182 FSHPVNYRKHLAS-H-GSAKSYGCPICGKLFGRPENRDVHLF------VHSICKAYICSVCGADY 238
            :....:.::|:.: | |..:...||.||.     :.||.|..      :|.....|:|.:|..::
  Fly   377 YYKNFSLQEHIRNVHMGKRRMLKCPFCGM-----QCRDAHKMARHRKEMHLSQGTYVCHLCQEEF 436

  Fly   239 ------------------MRR------------NQLIRHGLASGHHND-----PIVRQKPQFSPA 268
                              .||            ::.|.....:|..:|     |:..:..:....
  Fly   437 TDISYFDAHKRSIQCRSNTRRFVNADGNREGSDSESISGRNMNGQDDDYDGMGPLQEEYDEDDGL 501

  Fly   269 LAAKNR-------SQRSAIDESQDEELQWLKGVDALDSAGYLENSQFSNTGKMTAIFAEDENE 324
            |...|:       |.|..:|||:.:.:| |...|  |....:||          |:.|||..|
  Fly   502 LVEDNQPEEQGSPSNRQYLDESEQQYVQ-LSDYD--DQHLLVEN----------AVDAEDGGE 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 5/19 (26%)
C2H2 Zn finger 87..107 CDD:275368 4/19 (21%)
C2H2 Zn finger 115..136 CDD:275368 4/20 (20%)
C2H2 Zn finger 144..165 CDD:275368 6/20 (30%)
C2H2 Zn finger 175..195 CDD:275368 3/20 (15%)
C2H2 Zn finger 203..223 CDD:275368 7/25 (28%)
C2H2 Zn finger 231..247 CDD:275368 5/45 (11%)
CG2116NP_572444.2 C2H2 Zn finger 256..275 CDD:275368 5/19 (26%)
C2H2 Zn finger 285..305 CDD:275368 4/19 (21%)
PHA00733 <308..357 CDD:177301 13/51 (25%)
C2H2 Zn finger 313..334 CDD:275368 4/20 (20%)
C2H2 Zn finger 341..362 CDD:275368 6/22 (27%)
C2H2 Zn finger 370..388 CDD:275368 3/17 (18%)
C2H2 Zn finger 400..418 CDD:275370 7/22 (32%)
C2H2 Zn finger 429..447 CDD:275368 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.