Sequence 1: | NP_001259122.2 | Gene: | CG11398 / 31070 | FlyBaseID: | FBgn0040366 | Length: | 329 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001284974.1 | Gene: | CG3032 / 31648 | FlyBaseID: | FBgn0029928 | Length: | 431 | Species: | Drosophila melanogaster |
Alignment Length: | 278 | Identity: | 67/278 - (24%) |
---|---|---|---|
Similarity: | 99/278 - (35%) | Gaps: | 76/278 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 44 QGGSPSFVCRRCPALFLTREELAAH---------RP--------THRYQGGQQTPASE------- 84
Fly 85 -HACD--ACGRVF------QKHNALVDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVY 140
Fly 141 LHSCPEPG---------CKKRFQQR------------------RECD-------------QHVKT 165
Fly 166 VHQNERNLVCDTCSARFSHPVNYRKHL-ASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAY 229
Fly 230 ICSVCGADYMRRNQLIRH 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11398 | NP_001259122.2 | C2H2 Zn finger | 52..72 | CDD:275368 | 9/36 (25%) |
C2H2 Zn finger | 87..107 | CDD:275368 | 8/27 (30%) | ||
C2H2 Zn finger | 115..136 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 144..165 | CDD:275368 | 10/60 (17%) | ||
C2H2 Zn finger | 175..195 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 203..223 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 231..247 | CDD:275368 | 4/15 (27%) | ||
CG3032 | NP_001284974.1 | zf-AD | 13..95 | CDD:285071 | |
C2H2 Zn finger | 158..179 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 188..209 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 218..239 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 254..275 | CDD:275368 | 9/20 (45%) | ||
C2H2 Zn finger | 294..315 | CDD:275368 | 4/20 (20%) | ||
C2H2 Zn finger | 325..345 | CDD:275368 | 3/20 (15%) | ||
C2H2 Zn finger | 352..373 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 381..401 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 409..429 | CDD:275368 | 5/17 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24409 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |