DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11398 and LOC100007471

DIOPT Version :9

Sequence 1:NP_001259122.2 Gene:CG11398 / 31070 FlyBaseID:FBgn0040366 Length:329 Species:Drosophila melanogaster
Sequence 2:XP_021326585.1 Gene:LOC100007471 / 100007471 -ID:- Length:276 Species:Danio rerio


Alignment Length:273 Identity:79/273 - (28%)
Similarity:116/273 - (42%) Gaps:30/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KEAEILAL-----LPHTYEDEEL-SLNTEELQFEELNERSQHQQGGSPS----------FVCRRC 55
            :|:|.|.:     :.|..:..|| |||.|   .|:|||..:..|.|..|          |.|.:|
Zfish     6 EESEDLKIEDTFTVKHAEQQTELTSLNDE---CEDLNEIKEEDQDGQNSGVEKPPEKARFTCSQC 67

  Fly    56 PALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNALVDHMNAHNDVRNYPCPECPA 120
            ...||...:|..|...|       |......|..||:.|.|:..|..|:..|:..:.||||:|..
Zfish    68 GKTFLHHGKLKDHLRIH-------TGEKPFTCPQCGKSFNKNGNLKVHLRIHSGEKPYPCPQCGK 125

  Fly   121 RFVQRSNRECHLKNVHRKVYLHSCPEPGCKKRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHP 185
            .|..|...:.|:: ||......:||:  |.|.|:||.....|:: :|..|:..:|..|...|...
Zfish   126 SFYLRIKLKVHMR-VHTGESPFTCPQ--CGKSFKQRGNFVNHIR-IHTGEKPYICQQCGKSFHQD 186

  Fly   186 VNYRKHLASHGSAKSYGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLA 250
            ...:.|:..|...|.:.|..|||.|....|..||:.||:....:.|:.||..:.::..|.||...
Zfish   187 GGLKVHMRVHTGEKPFTCQQCGKSFNLQGNLKVHMRVHTGESPFTCTQCGLSFRQKISLKRHWRI 251

  Fly   251 SGHHNDPIVRQKP 263
            ........|.|:|
Zfish   252 HSAGKTFSVEQRP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11398NP_001259122.2 C2H2 Zn finger 52..72 CDD:275368 6/19 (32%)
C2H2 Zn finger 87..107 CDD:275368 7/19 (37%)
C2H2 Zn finger 115..136 CDD:275368 6/20 (30%)
C2H2 Zn finger 144..165 CDD:275368 8/20 (40%)
C2H2 Zn finger 175..195 CDD:275368 4/19 (21%)
C2H2 Zn finger 203..223 CDD:275368 8/19 (42%)
C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
LOC100007471XP_021326585.1 C2H2 Zn finger 64..84 CDD:275368 6/19 (32%)
COG5048 <88..248 CDD:227381 48/163 (29%)
C2H2 Zn finger 92..112 CDD:275368 7/19 (37%)
C2H2 Zn finger 120..140 CDD:275368 6/20 (30%)
C2H2 Zn finger 148..168 CDD:275368 8/22 (36%)
C2H2 Zn finger 176..196 CDD:275368 4/19 (21%)
C2H2 Zn finger 204..224 CDD:275368 8/19 (42%)
C2H2 Zn finger 232..252 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.