DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kirrel1 and DIP-epsilon

DIOPT Version :9

Sequence 1:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:510 Identity:100/510 - (19%)
Similarity:151/510 - (29%) Gaps:212/510 - (41%)


- Green bases have known domain annotations that are detailed below.


  Rat    63 TVVAGHRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAW-------------------PRYRVVG 108
            ||.||....|.|.:.|               :|....||                   ||..|..
  Fly    62 TVPAGRNVKLACSVKN---------------LGSYKVAWMHFEQSAILTVHNHVITRNPRISVTH 111

  Rat   109 SADAGQ--YNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPE-DTRIDGGPVILLQAGTP 170
            ......  :.|.|.:.:..|...|.||......:::...:.|::||. |..:....:| ::.|..
  Fly   112 DKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVV
PPNIDDALTSSDII-VREGDN 175

  Rat   171 YNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSM 235
            ..|.|:| ...|..||.|.||               ||      ::::|..|             
  Fly   176 VTLRCKA-KGSPEPTIKWKRD---------------DG------NKIVINKT------------- 205

  Rat   236 NEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAH 300
                         |:||...|.:|.:        ||:              .|...|.:|     
  Fly   206 -------------LEVHDLETDSLEL--------ERI--------------SRLHMGAYL----- 230

  Rat   301 ESRYETNVDYSFFTEPVSCEVYNKV-GSTNVSTLVNVHFAPRIVVYPKPTTTDIGSDVTLTCVWV 364
                              |...|.| .|.:....|:|.|:|.:.:..:.....||.::||.|...
  Fly   231 ------------------CIASNGVPPSVSKRIKVSV
DFSPMVWIPHQLVGIPIGFNITLECFIE 277

  Rat   365 GNPPLTLTWTKKDSNM--------GPRLPGSPP-EANLSAQVLSNSNQLLLKSVTQADAGTYTCR 420
            .||.....||:::..|        ...:||.|. :|.:         :|.:.:|..:|.|.|.|.
  Fly   278 ANPTSLNYWTRENDQMITESSKYKTETIPGHPSYKATM---------RLTITNVQSSDYGNYKCV 333

  Rat   421 AIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGT 485
            |..|| |..:..:.||::.||.                      :.|||            ...|
  Fly   334 AKNPR-GDMDGNIKLY
MSSPPT----------------------TQPPP------------TTTT 363

  Rat   486 LERYTVER-------------------------TNS--GSGVLSTLTINNVMEAD 513
            |.|.|...                         |||  .||..|...::|:.|.|
  Fly   364 LRRTTTTAAEIALDGYINTPLNGNGIGIVGEGPTNSVIASGKSSIKYLSNLNEID 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352 19/105 (18%)
Ig 57..148 CDD:299845 19/105 (18%)
Ig2_KIRREL3-like 170..251 CDD:143236 14/80 (18%)
I-set 255..336 CDD:254352 12/81 (15%)
Ig_2 259..337 CDD:290606 11/78 (14%)
Ig_2 340..437 CDD:290606 26/105 (25%)
IG_like 346..437 CDD:214653 25/99 (25%)
Ig5_KIRREL3 439..536 CDD:143306 18/102 (18%)
IG_like 451..536 CDD:214653 16/90 (18%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 20/107 (19%)
Ig 69..139 CDD:143165 14/84 (17%)
IG_like 165..249 CDD:214653 30/177 (17%)
IGc2 172..237 CDD:197706 26/157 (17%)
IG_like 267..348 CDD:214653 23/90 (26%)
Ig 270..339 CDD:299845 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.