Sequence 1: | XP_006232737.1 | Gene: | Kirrel1 / 310695 | RGDID: | 727883 | Length: | 805 | Species: | Rattus norvegicus |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
Alignment Length: | 256 | Identity: | 56/256 - (21%) |
---|---|---|---|
Similarity: | 92/256 - (35%) | Gaps: | 67/256 - (26%) |
- Green bases have known domain annotations that are detailed below.
Rat 59 PADQTVVAGH-RAVLPC-VLLNYSGIVQW--TKDGLALGMGQG-LKAWPRYRVVGSADAGQYNLE 118
Rat 119 ITDAELSDDASYECQATEAALRSRRAKLTVLIPPEDTR--IDGGPVILLQAGTPYNLTC--RAFN 179
Rat 180 AKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIQPTDLDIGRVFTCRSMNEAIPNGK- 243
Rat 244 --------ETS-----IELDVHHPPTVTLSIEPQ---TVLEGERVI---------FTCQAT 279 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Kirrel1 | XP_006232737.1 | I-set | 54..148 | CDD:254352 | 24/93 (26%) |
Ig | 57..148 | CDD:299845 | 24/93 (26%) | ||
Ig2_KIRREL3-like | 170..251 | CDD:143236 | 17/96 (18%) | ||
I-set | 255..336 | CDD:254352 | 8/37 (22%) | ||
Ig_2 | 259..337 | CDD:290606 | 8/33 (24%) | ||
Ig_2 | 340..437 | CDD:290606 | |||
IG_like | 346..437 | CDD:214653 | |||
Ig5_KIRREL3 | 439..536 | CDD:143306 | |||
IG_like | 451..536 | CDD:214653 | |||
dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 22/86 (26%) |
IG_like | 243..329 | CDD:214653 | 22/85 (26%) | ||
Ig | 350..464 | CDD:299845 | 27/145 (19%) | ||
IG_like | <441..477 | CDD:214653 | 6/26 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |