DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11379 and CG34181

DIOPT Version :9

Sequence 1:NP_001284766.1 Gene:CG11379 / 31062 FlyBaseID:FBgn0040362 Length:201 Species:Drosophila melanogaster
Sequence 2:NP_001097130.1 Gene:CG34181 / 5740634 FlyBaseID:FBgn0085210 Length:203 Species:Drosophila melanogaster


Alignment Length:178 Identity:44/178 - (24%)
Similarity:69/178 - (38%) Gaps:40/178 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IMAVLLHSVLGISYYYYFRESPG---SAAPLLGAWLFSACVVTLLHGVRMFSSALPADQRFRNGN 69
            |:||.|.:...:...|:|...|.   |.||.|.:|||....:..|..::::      .:||.:.:
  Fly     3 IVAVGLAAFFQLMGCYFFFAQPQDRCSPAPNLASWLFLGATLCFLWDIKIY------PRRFMHMS 61

  Fly    70 RNLRGNESSWASLLLETGVCCLVLDLTLSKLWHRIESLCQCAIVGILQALAVEEQTFLVCE---- 130
            |..|        :|:|......:.::....:|        ||:...|.:|..|......|.    
  Fly    62 RFWR--------ILIEIVASIFLAEVGTVIIW--------CALEKFLFSLTNELVNLTQCSCRPS 110

  Fly   131 ---YWTLGLTTGLIGACLLWLSLWAT---ALPQKLRCGM-----LDWR 167
               ||..||.|.||...:||..|.||   ...:|..|.:     :.||
  Fly   111 HFVYWLSGLITSLISGAMLWYVLEATDGVYYIKKFSCNLRTTMGVTWR 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11379NP_001284766.1 DUF4818 34..157 CDD:292707 31/132 (23%)
CG34181NP_001097130.1 DUF4818 32..140 CDD:292707 31/129 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.