DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and AT1G27200

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_564272.1 Gene:AT1G27200 / 839609 AraportID:AT1G27200 Length:575 Species:Arabidopsis thaliana


Alignment Length:166 Identity:36/166 - (21%)
Similarity:60/166 - (36%) Gaps:32/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 SYFTKVPTEFSNHEE----QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKW 488
            ||: |...|..|.||    ||||.       .|.:....:|.           ||.|:.....:.
plant   208 SYY-KCQFEIENSEEKEVTQAIAA-------AQEVVRCGLPE-----------SLKLNPEMMFRV 253

  Fly   489 LPGGCNPRTLNT----SIAQMQHYREPDDKYNLTNLTDDRSV----WKFAGELRAAVEY-VWLHL 544
            .....:||...|    |:|::......:.|...:.:..:..|    |..|..||..:.| .||.:
plant   254 SVIHIDPRGRTTPALPSVARIYGSDSIEKKEKKSGVKHELCVCTMLWNQAPFLREWIMYHSWLGV 318

  Fly   545 DDVLAQVSDPEEQQQQLEESLDQEGDDLDREQQPLV 580
            :......::.::..|:..|.|..|..::.|...|.:
plant   319 ERWFIYDNNSDDGIQEEIELLSSENYNVSRHVWPWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 30/135 (22%)
AT1G27200NP_564272.1 Glyco_transf_92 290..520 CDD:396317 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.