DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and AT4G37420

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_195458.1 Gene:AT4G37420 / 829896 AraportID:AT4G37420 Length:588 Species:Arabidopsis thaliana


Alignment Length:161 Identity:26/161 - (16%)
Similarity:44/161 - (27%) Gaps:71/161 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 IY--AYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLR----------------------- 344
            ||  |:.....||..|.:.|...|  .:.....|:||..|:|                       
plant    66 IYRAAFFATTRPAKSRFVSYVINT--QDSNHHQLSNGSRRIRAEAVLWPGWEILVIVSPEEKAKP 128

  Fly   345 ------HYQHMLLQHRKLEKRLNELIPYND-----CFYRNLYRHDY------------------- 379
                  :|........|...|...::|:::     |....:|||.:                   
plant   129 PPFPGENYICFYPNGEKSTARFAAILPFSNRASFRCSLPGIYRHHHPIPTPILASSKRFQLSPET 193

  Fly   380 --------------LVNVDVDEVIMPLGDNR 396
                          .::.:.|.|::..|.||
plant   194 RWPDLPLWNFVVFEAISTETDVVLLVKGPNR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 26/161 (16%)
AT4G37420NP_195458.1 Glyco_transf_92 311..541 CDD:279961
WcaA 316..>525 CDD:223539
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.