DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and AT3G07380

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_187394.1 Gene:AT3G07380 / 819926 AraportID:AT3G07380 Length:102 Species:Arabidopsis thaliana


Alignment Length:63 Identity:15/63 - (23%)
Similarity:30/63 - (47%) Gaps:7/63 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 VHPAVQRVLDYYQRTGYLELRPLT---LANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFY 371
            :...::.:.:|:|.|  :||.|::   ..:|....|.|:...::  ||..|..:.:|..|..|
plant    22 ISSVMESLEEYFQFT--IELMPMSSQVCYSGDGPARTYRKWGIE--KLAYRDVKKVPRRDRKY 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 15/63 (24%)
AT3G07380NP_187394.1 Glyco_tranf_GTA_type <2..>101 CDD:416254 15/63 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.