powered by:
Protein Alignment CG11384 and AT3G07380
DIOPT Version :9
Sequence 1: | NP_569887.1 |
Gene: | CG11384 / 31061 |
FlyBaseID: | FBgn0040363 |
Length: | 588 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_187394.1 |
Gene: | AT3G07380 / 819926 |
AraportID: | AT3G07380 |
Length: | 102 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 15/63 - (23%) |
Similarity: | 30/63 - (47%) |
Gaps: | 7/63 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 VHPAVQRVLDYYQRTGYLELRPLT---LANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFY 371
:...::.:.:|:|.| :||.|:: ..:|....|.|:...:: ||..|..:.:|..|..|
plant 22 ISSVMESLEEYFQFT--IELMPMSSQVCYSGDGPARTYRKWGIE--KLAYRDVKKVPRRDRKY 80
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4735 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.