DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and GALS1

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_565768.1 Gene:GALS1 / 817922 AraportID:AT2G33570 Length:496 Species:Arabidopsis thaliana


Alignment Length:448 Identity:87/448 - (19%)
Similarity:153/448 - (34%) Gaps:159/448 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 WQTFVNANVTFRLYAAYLDKRKGLKLPTV-RILATANQIDNEFPPTHC--QMWFEGYRQPIFVPV 178
            :|.|.||...|.|..||   |.|   ||. .::..|::      |.|.  :.|::          
plant   102 FQPFGNAAALFVLMGAY---RGG---PTTFSVIGLASK------PIHVYGKPWYK---------- 144

  Fly   179 AEFLS---VWVEAWGNK--PNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRVN 238
            .|::|   ..:.|...|  |:..|..:.:..|.:    .|.||.|.:        :..|..|.:|
plant   145 CEWISNNGTSIRAKAQKILPDWGYGRVYTVVVVN----CTFNSNPNS--------DNTGGKLILN 197

  Fly   239 MNRKQSLPVVIPPSQNPK--------SQNATIQSQNEALQNFGVCLKGFDFPYVDLS-------E 288
            ....:|          ||        .::|.|..:::....:     .:|:.|...|       .
plant   198 AYYNES----------PKLFERFTTLEESAGIYDESKYSPPY-----QYDYLYCGSSLYGNVSAS 247

  Fly   289 RLIEWFELQRILGASRIYAYMYD---VHPAVQRVLDYYQRTGYL---ELRPLTLANGMPRLRHYQ 347
            |:.||..........:.:...:|   |.|.|::||:.:.|.|.:   .:|..:..:|     :| 
plant   248 RMREWMAYHAWFFGDKSHFVFHDAGGVSPEVRKVLEPWIRAGRVTVQNIRDQSQYDG-----YY- 306

  Fly   348 HMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVI-MPLGDN---------------- 395
                        .|:.:..|||.:|..|..::....||||.| :|.|:.                
plant   307 ------------YNQFLIVNDCLHRYRYAANWTFFFDVDEYIYLPHGNTLESVLDEFSVNTQFTI 359

  Fly   396 -------------------RNW--HQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSN 439
                               |.|  .:|:.|....::.:..|.     |:...|::.|.|      
plant   360 EQNPMSSVLCINDSSQDYPRQWGFEKLLFKDSRTKIRRDRKY-----AIQAKNAFATGV------ 413

  Fly   440 HEEQAIAGELYVLQHTQ-RIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPR 496
            |..:.|.|:  .|..|: :|:.|.        :||   ::|:|.....:.||.....:
plant   414 HMSENIVGK--TLHKTETKIRYYH--------YHN---TITVHEELCREMLPNSAKKK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 52/278 (19%)
GALS1NP_565768.1 Glyco_transf_92 231..439 CDD:396317 48/249 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.