DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and si:zfos-464b6.2

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_003200543.3 Gene:si:zfos-464b6.2 / 794433 ZFINID:ZDB-GENE-030131-5337 Length:474 Species:Danio rerio


Alignment Length:357 Identity:95/357 - (26%)
Similarity:149/357 - (41%) Gaps:72/357 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LSCPVPSELPPPTVNSFPKTVSLV--ARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQ 263
            ::||:..|...||      .|:|.  |.|.|.. .|.:..|||  .:|...|             
Zfish   164 IACPLNDECLKPT------HVALTSSANHSESI-TSFQSIMNR--DVPAAFP------------- 206

  Fly   264 SQNEALQNFGVCLK-GFDFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTG 327
                  ..|.||:. .:|:..|   ..|:|..|:.|:|||:|:..|..:....||:|||||...|
Zfish   207 ------HQFTVCISVMYDYTNV---LNLVEAMEMFRLLGATRVAIYRTNCDSNVQKVLDYYVERG 262

  Fly   328 YLELRPLTLANGMPRLR-----------HYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLV 381
            ::|:.|.|:...:...|           ||             ..::...|||.||.:|:..|:.
Zfish   263 FVEVIPWTIKKHVQVSRGWRKDVSGGELHY-------------YGQIPALNDCVYRYMYQSRYVA 314

  Fly   382 NVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYF---TKVPTEFSNHEEQ 443
            ..|:||:|:|.| .:.|.:::..   ||     |..|......|.|:.|   :|....:..::.:
Zfish   315 LHDMDELILPFG-VKTWTEMLPN---LE-----KMYGTTFGFEFENNQFPFTSKANRRYDVNDWE 370

  Fly   444 AIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHY 508
            ::.| ..:|::.||:.|........|...|.||.|....|..|..:..|.:...:|.::|:|.|.
Zfish   371 SVRG-TNILKYIQRVPNDPNAFNNFKVIVNPRLVLMATVHGLLDTVNVGKHTVRVNRNVARMYHS 434

  Fly   509 REPDDKYNLTNLTDDRSVWKFAGELRAAVEYV 540
            :......| |||..|..:|.:|.||..||..|
Zfish   435 KNLTYPLN-TNLIPDNHLWDYADELIPAVTKV 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 79/285 (28%)
si:zfos-464b6.2XP_003200543.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17153
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.