DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and si:dkey-56i24.1

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001116761.1 Gene:si:dkey-56i24.1 / 568129 ZFINID:ZDB-GENE-081105-8 Length:436 Species:Danio rerio


Alignment Length:342 Identity:80/342 - (23%)
Similarity:135/342 - (39%) Gaps:50/342 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 KTVSL-VARHCEKAGNSLRV--------NMNRKQSLPVVIPPSQNPKSQNATIQSQNEAL----- 269
            |||.. |..|.:..|....|        ||.....:.:...|:::..:.|......|..|     
Zfish   100 KTVETEVQIHTDHFGFPFHVSDVICKGKNMQSASHVLITTHPTKHLYNINMEYLPINNNLVTDNF 164

  Fly   270 -QNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLEL-- 331
             .||.||:......|.::.: ..:..|:.::||...:..|.......::::|.:|:..|:||:  
Zfish   165 KYNFTVCISNLFGSYNNVLQ-FAQTMEMYKLLGVQHVVIYNTSCGADLKKLLKHYESEGFLEIVS 228

  Fly   332 RPL-TLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGDN 395
            .|: ...|..|.....:|....|     ...:|:..|:|.||::|:..|::..|:||:|||. ..
Zfish   229 WPIDKFLNPSPGWNFQEHKGDLH-----YYGQLVTLNECIYRHMYQSRYVLLNDIDEIIMPY-KY 287

  Fly   396 RNWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTE----FSNHEEQAIAGELYVLQHTQ 456
            .|...|::...:.:...|        .....|..|.|...|    |...|.:.|:| :.:::|..
Zfish   288 SNLQSLMEDLQSADPSNG--------VFLIENHIFPKTQFEDSGKFKREEWKNISG-INIMEHIY 343

  Fly   457 R---IKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYREPDDKYNLT 518
            |   .||...|   ||...|.|.......|.:||...|..:   :..::.::.|.|.|...: ||
Zfish   344 REPERKNVYNP---TKMIVNPRKVEQTSVHSSLKNFGGSYH---VPFNVCRIVHVRVPLQGH-LT 401

  Fly   519 --NLTDDRSVWKFAGEL 533
              .|..|:.||.|...|
Zfish   402 KEELFVDKRVWDFENNL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 67/275 (24%)
si:dkey-56i24.1NP_001116761.1 Glyco_transf_92 166..403 CDD:279961 61/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.